KEGG   Penicillium rubens: Pc14g01730Help
Entry
Pc14g01730        CDS       T01091                                 

Definition
(RefSeq) Pc14g01730
  KO
K03245  
translation initiation factor 3 subunit J
Organism
pcs  Penicillium rubens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Pc14g01730
Ribosome biogenesis [BR:pcs03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    Pc14g01730
Translation factors [BR:pcs03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Pc14g01730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MPPSKWDDEEEESSTPPIVAAPRRRFDDEEEEEVLDSWDAAEDSEVEREKAKKAEEAEAK
AKAAAAANKKTKAQRIEELRQQRQREKGDDESESEDETTRRARLRKTEQEADLAHAEDLF
GSVDVKPNKGAPKAIVVSDSTDPTKAIDLSAMPLFKPTTKDQFTRLSETLVPLLTLHSKK
PHYALWAQDFTRKLVKELPSTEIKKIASALTTASNEKMREERAADKGNKKSKAAKTKISL
NASRDIHADNTNYDDGGDLGDDDFM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccgccttccaagtgggatgatgaagaagaggagagctctacgcctcctattgttgcc
gcaccccgccgtcgcttcgacgatgaagaggaagaagaagttcttgactcatgggatgcc
gccgaagactccgaggtagagcgcgagaaggccaagaaggccgaagaagctgaggccaag
gccaaggctgccgccgccgccaacaagaagaccaaagcccagcggatagaggaactccga
cagcagcgccaacgcgagaagggcgacgacgaatccgagagcgaggacgagacaacccgc
cgtgctcgtctgcgcaagaccgagcaggaagccgatcttgcccacgccgaggatcttttc
ggctctgttgatgtcaagcccaacaagggagcccccaaggccattgtcgtcagcgactca
accgatcctaccaaggccatcgatctgtccgccatgccgctgttcaagcccaccaccaag
gaccagttcacccgcctgagcgagacccttgtgccactcctcaccctgcactccaagaag
cctcactacgctctctgggcgcaggacttcacccgtaagcttgtgaaggagctgcctagt
actgagatcaagaagattgccagtgccctcactactgcctccaacgagaagatgcgcgag
gagcgtgccgctgacaagggcaacaagaagtccaaggcagcaaagaccaagatctccctg
aatgctagccgcgacatccatgccgataacaccaactacgacgatggtggtgatcttggg
gatgatgactttatgtga

DBGET integrated database retrieval system