KEGG   Penicillium chrysogenum: Pc15g00990Help
Entry
Pc15g00990        CDS       T01091                                 

Definition
Pc15g00990
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pc15g00990
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Pc15g00990
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Pc15g00990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MIGFYQSFLVITFGVLVSAANFSLFGITIDIPLPERPCGNHNRDVRKEWGELKRAERIDY
TNAVLCMQGKPQHLPREEYPGVRNRFDDFVATHINYTLNVHLSGLFLPWHRHFLWLWEKA
LREECDYPGHLPYWNWPLWSENLKASPLFDCSDSSLSGDGEYNPGEQSLSGGAVTIPRGT
GGGCVRCGPFKDMQIHMGPFDRNIVSFAKLPAPGFDYNPRCLNRSLNNFVSSNYDNETIV
DRLLAAPNMSDFQTIMDYWPARPKGVLGVHGGGHFSLGATLQDLFTSPQDPAFMLHHGMI
DRLWSMWQAKDEDHRRFALNGTSMLLNPPNATLVTVDMEMEFGVLDRPRSVGEVMDPTRY
GYCYSYS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtttttatcagtctttcttggtcatcacctttggggttttggtttcggcagcg
aacttctccctattcggtatcaccatcgacattcccctaccagagcgaccgtgcggaaat
cacaaccgtgatgtacggaaggaatggggagagctgaagcgagctgagaggatcgactat
actaatgcagtgttatgtatgcaagggaagccccaacatcttccaagagaagagtaccca
ggagtgcggaaccgtttcgatgattttgtggccacccatatcaactacacactcaatgtc
caccttagtggtctgttcctcccatggcaccgtcacttcctctggctctgggagaaagcc
ctgcgggaagagtgtgattaccctggacatctcccgtattggaactggccattatggtca
gagaacctaaaggccagccctctcttcgattgcagcgacagctccctctccggtgacggg
gagtacaacccgggcgaacaaagcctctcgggcggcgccgtaaccataccacgcggaacg
ggcggcggctgcgtgcgatgcggacccttcaaagacatgcaaatccacatgggaccgttt
gaccggaacatcgtctcattcgccaaactccccgccccaggctttgactacaaccctcgc
tgtttgaaccgaagtctgaacaatttcgtcagtagcaactacgacaacgagaccatcgtc
gacagactcctggcggcgcccaacatgtccgatttccaaactatcatggactactggccc
gcacgacccaagggggtgttgggtgtgcacggcggcgggcatttcagcctcggggcgacc
ctccaagacctatttacgtcgccgcaagacccggctttcatgctgcaccacggtatgatc
gatcggttgtggagtatgtggcaggcgaaggacgaggaccatcgtcggttcgcacttaac
ggtacaagtatgctcctcaacccgccgaatgcgacacttgtcacggtcgatatggagatg
gaattcggtgttcttgatcggcctcggtcggtcggcgaggttatggatccgactcgatac
gggtattgttattcgtacagttga

DBGET integrated database retrieval system