KEGG   Penicillium chrysogenum: Pc16g00620Help
Entry
Pc16g00620        CDS       T01091                                 

Definition
Pc16g00620
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc16g00620
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Pc16g00620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MAPRFWTALWALTLGHAVVATPQILAPRATGSLDTWLASETVVARQGILDNIGSAGAHAA
NAKPGVVLASPSTSDPDYYYTWTRDSALVFKNLVDMFRSGDSALLEVIEEYISSQAYIQT
VSNPSGGLSGGGGLGEPKFNADETAFTGSWGRPQRDGPALRATALISFGQWLIDNGYTTY
ATDIVWPVVRNDLSYVSQYWNQTGFDLWEEVSGSSFFTVAAQHRALVEGSTFASQVGSSC
LYCDSQAPQVLCFLQSFWTGSYILANFGGGRSGKDANTLLGSIHTFDPEAGCDDTTFQPC
SARALANHKVVTDSFRSIYSVNSGIAAGKAVSVGRYPEDSYYNGNPWYLCTLAAAEQLYD
AIYTWNRIGSLTITSVSLSFFKDLYSSAATGTYSSSSDTYSSIVAAVKEYADGYVSIVEK
YAASSGSLSEQFSKSDGSQLSARDLTWSYAALLTANERRNAIVPAPWGETSASSVPGQCQ
YTSAIGTYSSATNTAWPTTLTSGSGSVTTTKTTTTTSKPTTTSCTTPTTVAVTFNVIATT
EYGQNIKLAGSISQLGSWSPSSAVALSASKYTTSNHLWFVTVTLPVGTSFSYKYIQVASD
GTIKWESDPNQSYTVPATCGTTAVTVSDTWR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcgtttttggactgcgctttgggcgcttacgcttggccatgccgttgtggcc
acgccacagatattggctcctcgtgcgactggcagtttggatacctggttggcgtctgag
actgtggtggcaagacagggtatcttggacaacatcggatcggctggtgcccatgctgcc
aatgcaaagccgggcgttgtactcgccagcccgagtacctccgaccctgattattattat
acttggactcgtgactcggccctagtgttcaaaaatctggtcgacatgttcaggagcggc
gacagcgctttgttggaggttatcgaagaatacatcagctcgcaggcctatatccagacg
gtgtcaaatccatctggaggtctttccggcggcggtggattgggagagcccaagttcaac
gccgatgagacagctttcactggctcttggggacgccctcagcgtgatggaccagccttg
cgagccactgccttgatctcatttggccaatggcttattgacaatgggtacaccacctac
gcgaccgacattgtctggcctgtcgtgcgcaatgatctctcctatgtttcccagtactgg
aatcagactggatttgatctctgggaagaagtttctggctcatcattcttcaccgtcgcg
gctcagcaccgcgctttggtggagggaagcacattcgcaagtcaggtcggttcttcatgt
ttgtactgtgactcccaggctccgcaggttctgtgcttcctacagtccttctggactgga
tcttacattctggccaactttggtggtggccgctctgggaaggacgccaatacactgctc
ggcagcattcacacattcgacccagaggcaggatgcgatgacacgacgttccagccttgc
tcagcacgagcactcgcaaaccacaaagttgtaactgactcgttccgatcgatctactct
gtcaactctggtatcgctgcgggtaaggctgtttctgttggtcgatacccagaggactca
tactacaatggtaacccttggtacctgtgcactttggctgcagctgagcagttgtatgat
gctatctacacatggaaccgtattggttctttgaccattacctctgtctctttgagcttc
ttcaaagacctatacagctctgctgcgaccggcacctactcctcatccagtgatacatac
tcctcgatcgtggccgctgtaaaggaatatgcagatggatatgttagcatcgtggaaaaa
tacgctgcatcaagtggttccttgtccgagcaattctccaagtcagatggctcgcagctg
tcagctcgtgacctgacttggtcctacgcagccctacttactgccaatgagcgtcgaaac
gccatagtccctgcaccatggggggagacatctgctagcagtgtccctgggcagtgtcaa
tatacttcggccattggtacttacagcagcgcaacaaacaccgcctggcctaccactttg
actagtggatcgggcagtgtaactaccaccaagacgactaccactacctcgaagccgaca
acaacatcatgcactactccgaccactgttgcagtgacgttcaatgtgattgctactact
gaatatggccagaacatcaaactcgctggatctatctctcaacttggctcatggtcgcca
agcagtgctgtcgcattgagcgcttccaaatacaccacgagcaaccacctgtggtttgtg
accgtgacacttccagtaggcactagcttcagctacaagtacatccaggtggcgagcgat
ggcactatcaagtgggaaagtgacccaaaccagtcgtataccgttcccgccacgtgtggt
actactgctgtcaccgtcagtgatacatggaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system