KEGG   Penicillium chrysogenum: Pc16g00620Help
Entry
Pc16g00620        CDS       T01091                                 

Definition
Pc16g00620
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pcs00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MAPRFWTALWALTLGHAVVATPQILAPRATGSLDTWLASETVVARQGILDNIGSAGAHAA
NAKPGVVLASPSTSDPDYYYTWTRDSALVFKNLVDMFRSGDSALLEVIEEYISSQAYIQT
VSNPSGGLSGGGGLGEPKFNADETAFTGSWGRPQRDGPALRATALISFGQWLIDNGYTTY
ATDIVWPVVRNDLSYVSQYWNQTGFDLWEEVSGSSFFTVAAQHRALVEGSTFASQVGSSC
LYCDSQAPQVLCFLQSFWTGSYILANFGGGRSGKDANTLLGSIHTFDPEAGCDDTTFQPC
SARALANHKVVTDSFRSIYSVNSGIAAGKAVSVGRYPEDSYYNGNPWYLCTLAAAEQLYD
AIYTWNRIGSLTITSVSLSFFKDLYSSAATGTYSSSSDTYSSIVAAVKEYADGYVSIVEK
YAASSGSLSEQFSKSDGSQLSARDLTWSYAALLTANERRNAIVPAPWGETSASSVPGQCQ
YTSAIGTYSSATNTAWPTTLTSGSGSVTTTKTTTTTSKPTTTSCTTPTTVAVTFNVIATT
EYGQNIKLAGSISQLGSWSPSSAVALSASKYTTSNHLWFVTVTLPVGTSFSYKYIQVASD
GTIKWESDPNQSYTVPATCGTTAVTVSDTWR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcgtttttggactgcgctttgggcgcttacgcttggccatgccgttgtggcc
acgccacagatattggctcctcgtgcgactggcagtttggatacctggttggcgtctgag
actgtggtggcaagacagggtatcttggacaacatcggatcggctggtgcccatgctgcc
aatgcaaagccgggcgttgtactcgccagcccgagtacctccgaccctgattattattat
acttggactcgtgactcggccctagtgttcaaaaatctggtcgacatgttcaggagcggc
gacagcgctttgttggaggttatcgaagaatacatcagctcgcaggcctatatccagacg
gtgtcaaatccatctggaggtctttccggcggcggtggattgggagagcccaagttcaac
gccgatgagacagctttcactggctcttggggacgccctcagcgtgatggaccagccttg
cgagccactgccttgatctcatttggccaatggcttattgacaatgggtacaccacctac
gcgaccgacattgtctggcctgtcgtgcgcaatgatctctcctatgtttcccagtactgg
aatcagactggatttgatctctgggaagaagtttctggctcatcattcttcaccgtcgcg
gctcagcaccgcgctttggtggagggaagcacattcgcaagtcaggtcggttcttcatgt
ttgtactgtgactcccaggctccgcaggttctgtgcttcctacagtccttctggactgga
tcttacattctggccaactttggtggtggccgctctgggaaggacgccaatacactgctc
ggcagcattcacacattcgacccagaggcaggatgcgatgacacgacgttccagccttgc
tcagcacgagcactcgcaaaccacaaagttgtaactgactcgttccgatcgatctactct
gtcaactctggtatcgctgcgggtaaggctgtttctgttggtcgatacccagaggactca
tactacaatggtaacccttggtacctgtgcactttggctgcagctgagcagttgtatgat
gctatctacacatggaaccgtattggttctttgaccattacctctgtctctttgagcttc
ttcaaagacctatacagctctgctgcgaccggcacctactcctcatccagtgatacatac
tcctcgatcgtggccgctgtaaaggaatatgcagatggatatgttagcatcgtggaaaaa
tacgctgcatcaagtggttccttgtccgagcaattctccaagtcagatggctcgcagctg
tcagctcgtgacctgacttggtcctacgcagccctacttactgccaatgagcgtcgaaac
gccatagtccctgcaccatggggggagacatctgctagcagtgtccctgggcagtgtcaa
tatacttcggccattggtacttacagcagcgcaacaaacaccgcctggcctaccactttg
actagtggatcgggcagtgtaactaccaccaagacgactaccactacctcgaagccgaca
acaacatcatgcactactccgaccactgttgcagtgacgttcaatgtgattgctactact
gaatatggccagaacatcaaactcgctggatctatctctcaacttggctcatggtcgcca
agcagtgctgtcgcattgagcgcttccaaatacaccacgagcaaccacctgtggtttgtg
accgtgacacttccagtaggcactagcttcagctacaagtacatccaggtggcgagcgat
ggcactatcaagtgggaaagtgacccaaaccagtcgtataccgttcccgccacgtgtggt
actactgctgtcaccgtcagtgatacatggaggtag

DBGET integrated database retrieval system