KEGG   Penicillium rubens: Pc16g01050Help
Entry
Pc16g01050        CDS       T01091                                 

Definition
(RefSeq) Pc16g01050
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pcs  Penicillium rubens
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Pc16g01050
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Pc16g01050
Ubiquitin system [BR:pcs04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    Pc16g01050
  UBL-specific proteases (ULPs)
   Pc16g01050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MFNLGVQVINGQKTFIPLENNPEVHTHLCKNLGVSPSLTFHDILSTTPEMLSWIPRPVNA
LILLCDKPIYLAARSRVEHSIPEYLGSGADEPVLWMKQTIGHACGLMALLHVVTNLENGK
YVLAGSELEKIVKRAVGLGPVERARLLYDSRFLEEAHMDAASEGSSIVPLPQEECGFHFI
AFVKKDGKVWELNGGMNGPLLRGELEGDLLGEEGLDMTVREFLSAADTEVHRGMSIIAVN
NTM
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttaggcgtccaggtcatcaacggccaaaagacctttataccactagagaac
aatccagaggtccatacgcatctatgtaagaacctcggagtatccccgagcctcacattc
catgatatcctctccactaccccagaaatgctctcctggatcccacgacctgtaaacgcc
ctcatcctcctctgcgataaacccatctacctcgccgcccggtctcgtgtcgaacacagt
atacccgagtatctcggcagcggggccgacgagcccgtgctgtggatgaagcagacgatc
ggacatgcgtgtgggctgatggcattactgcatgtggtgaccaatttggagaatgggaaa
tatgtcctggcgggatcagagctggagaagattgtgaagcgggcggttgggctggggccg
gtggagagggcgcggctcttgtatgattcgaggtttctggaagaggcgcatatggatgcg
gcgtcggaggggtcctcgattgtacctttgccgcaggaggaatgtggatttcattttatt
gcttttgttaagaaagatgggaaggtctgggaattgaatggagggatgaacggtccatta
ttgcgaggtgaattggagggggacttgttgggagaggaagggctggatatgacggtaagg
gagtttttaagtgctgccgacacggaagttcataggggaatgagtattattgccgtgaat
aatacgatgtga

DBGET integrated database retrieval system