KEGG   Penicillium chrysogenum: Pc16g01700Help
Entry
Pc16g01700        CDS       T01091                                 

Definition
Pc16g01700
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pcs  Penicillium chrysogenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pc16g01700
Enzymes [BR:pcs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pc16g01700
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pc16g01700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MSFSNLVSDIAFRDARVDDGSSQISHARSHRSHATARSYASTAATSVSISGEVSSQLHSG
YSHPLTRAWQADRQLTKDMLIYPLFITDNPDEETSIPSLPNQYRRGINRLVPFLAPLVRK
GLRSVMLFGVPLQPSAKDALGTAADDPDGPVIQAIRLLRSRFPQLYITTDVCLCEYTSHG
HCGILREDGSLDNAQSVDRISDVAIAYAAAGAHCVAPSDMNDGRIRAIKLKLIEAGMAHR
VLLMSYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDMAEGADIIM
VKPASSYLDIIRDAKDLAPDLPVAAYQVSGEFAMIHAAAKAGVFNLKDMAFESTEGILRA
GAGIVISYFVPEFLDWL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcaaatttggtctccgacattgcctttcgtgatgcccgtgtggatgatggc
agctcgcaaatctctcacgcccgatctcaccggtctcatgcgaccgctcggtcgtacgcc
agcaccgcagccacaagcgtcagcatttctggcgaagtttccagccagctacactccgga
tacagtcatcccctgaccagagcatggcaggctgataggcaattgacaaaggatatgctc
atatatccattgtttatcacagacaacccggacgaggagacatcaattccctcgttgccg
aatcaataccgccgtggaattaatcgcctggttcctttccttgccccccttgttcggaag
gggctgcgctcagtaatgctatttggtgtcccgcttcaaccgtccgccaaagatgcactt
ggaaccgccgcagatgacccagatggtcctgtaattcaagcgattcgtcttctccggtct
cgtttccctcaactttatatcacaaccgatgtatgtctctgcgagtatacttcgcacggc
cactgtggtatcttacgagaagatggatctcttgacaatgcgcaatccgttgaccggatc
tccgatgtagctattgcctacgcggcggctggagctcactgcgtggccccgtcagacatg
aacgacggaaggatccgggctatcaagctcaagttgattgaagctggtatggcacaccgt
gtacttttgatgtcttacagtgccaaattcagcggctgcttatatggaccgttccgtgat
gcggctggctcctgtccctcattcggggatcgtcggtgctaccagcttcccccaggcggc
cgcggtcttgcccgacgtgcgatacagagagatatggccgaaggtgcagatattatcatg
gtcaagccagctagcagctaccttgatatcatccgggatgccaaggatttggcaccggat
cttccagtggccgcctaccaagtcagtggtgaatttgcaatgatccatgccgctgccaag
gccggtgtcttcaatctcaaggatatggccttcgaaagcaccgaaggcatattgagagca
ggcgctgggattgtgatcagttatttcgtcccagaattcctcgactggctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system