KEGG   Penicillium chrysogenum: Pc16g01840Help
Entry
Pc16g01840        CDS       T01091                                 

Definition
Pc16g01840
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pcs  Penicillium chrysogenum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pcs00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 196 aa AA seqDB search
MASAYRPIVISGPSGTGKSTLLKRLFAEYPDTFGFSISETTRSPRPGEQDGREYNFVTKD
AFLDLVAKNGFIEHAQFGGNFYGTSVQAVKNIAEKKRICILDIEMEGVKQVKRTDLNARF
LFLAPPSLEVLEQRLRGRGTETEESLQRRLTQARNELEYANQPAAHDKIVVNDDLEKAYA
ELRDWVVDGGKFGAAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcataccgccctattgtgatttcaggcccatcggggactggaaagtcgact
ctgctcaagaggttgttcgccgagtatcctgatacgtttggattctctatctcggaaact
acacgatccccgagacctggcgagcaagatggccgtgaatataacttcgtcacaaaagac
gctttcctcgacctagtggctaagaacgggtttattgaacatgctcaatttggcgggaat
ttctatgggacgtcggtccaggctgtcaagaacattgccgagaagaagcgtatctgcata
ctggacattgagatggaaggagtcaagcaggtgaagcggacggatcttaatgcgcgtttc
ttgttccttgcgccgccttctctcgaggtgctggagcagcgcctccgtggtcgtggcact
gagaccgaagaatctctacagagaagacttactcaagctcgcaacgagcttgagtatgca
aaccaacccgcggctcacgataagattgtggttaacgacgatctagagaaagcgtatgct
gaattgcgggattgggttgttgacggtggtaagttcggtgctgcgcaatag

DBGET integrated database retrieval system