KEGG   Penicillium chrysogenum: Pc16g01840Help
Entry
Pc16g01840        CDS       T01091                                 

Definition
Pc16g01840
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pcs  Penicillium chrysogenum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pc16g01840
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pc16g01840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 196 aa AA seqDB search
MASAYRPIVISGPSGTGKSTLLKRLFAEYPDTFGFSISETTRSPRPGEQDGREYNFVTKD
AFLDLVAKNGFIEHAQFGGNFYGTSVQAVKNIAEKKRICILDIEMEGVKQVKRTDLNARF
LFLAPPSLEVLEQRLRGRGTETEESLQRRLTQARNELEYANQPAAHDKIVVNDDLEKAYA
ELRDWVVDGGKFGAAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcataccgccctattgtgatttcaggcccatcggggactggaaagtcgact
ctgctcaagaggttgttcgccgagtatcctgatacgtttggattctctatctcggaaact
acacgatccccgagacctggcgagcaagatggccgtgaatataacttcgtcacaaaagac
gctttcctcgacctagtggctaagaacgggtttattgaacatgctcaatttggcgggaat
ttctatgggacgtcggtccaggctgtcaagaacattgccgagaagaagcgtatctgcata
ctggacattgagatggaaggagtcaagcaggtgaagcggacggatcttaatgcgcgtttc
ttgttccttgcgccgccttctctcgaggtgctggagcagcgcctccgtggtcgtggcact
gagaccgaagaatctctacagagaagacttactcaagctcgcaacgagcttgagtatgca
aaccaacccgcggctcacgataagattgtggttaacgacgatctagagaaagcgtatgct
gaattgcgggattgggttgttgacggtggtaagttcggtgctgcgcaatag

DBGET integrated database retrieval system