KEGG   Penicillium chrysogenum: Pc16g02050Help
Entry
Pc16g02050        CDS       T01091                                 

Definition
Pc16g02050
Orthology
K14298  
mRNA export factor
Organism
pcs  Penicillium chrysogenum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pcs03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MSLFGGGASSASAGQTNTTGDISKDVALNAPPEDGISDLRFSPTSEHLAVASWDKKVRIY
EINDQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARMLDLSSGTTTQVAAHDAP
IRSCHMIPNPSVGGTPLLITGSWDKTVKYWDLRQSTAIASVECQERVYTMDVKNKLLVIG
TADRYINIINLDQPTKFYKTMQSPLKWQTRVVSCFSDASGFAVGSVEGRCAIQYVEEKDS
ASNFSFKCHRETPPANRDVCNIYSVNAISFHPIHGTFSTAGADGTFHFWDKDAKHRLKGY
PAVGGPITTTAFNRNGNIFAYSVSYDWSKGYSANTQQTVNKVMLHPIGPDETKPRPNTRK
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttttcggcggtggcgcgtcgtcggcctcggcgggccagacaaataccaccggc
gacatttccaaggacgtcgccctcaacgctcctccagaggacggtatctccgatctccgc
ttctcgcctaccagcgaacatctagccgtggcttcgtgggataagaaagtccgcatctac
gagatcaacgaccagggacaaagtgaaggaaaggcactcttcgagcacgaagctccagtt
ctgaactgctgctggtctccagatggaaccaaggtcgtcggtgctggtgccgacaaggca
gcccgcatgctcgatctcagttcaggcaccacaacccaagttgccgcccacgatgccccc
attcgaagctgccatatgatccccaatccctccgtgggcggaactccactcctgatcacc
ggctcgtgggacaagacggtcaaatactgggatctgcgccagtcgactgcaatcgcttcc
gtcgagtgccaggagcgtgtctacaccatggacgttaagaacaagctgctcgtcatcggc
accgcggaccgctacatcaatatcatcaacctcgaccagccaacaaagttctacaagacc
atgcaatcacccctcaagtggcagacgcgggtagtcagctgcttctcagatgcctcgggc
ttcgccgtcggctcggtggagggtcgctgcgctattcagtacgtcgaggagaaggattcc
gcctcgaacttctccttcaagtgccaccgtgaaaccccacccgcaaaccgcgatgtctgc
aatatctactccgttaacgctatttctttccaccccattcatggcaccttcagcactgca
ggtgccgatggtactttccacttctgggataaggatgcgaagcaccgtctcaagggttac
cccgctgtcggaggtcccatcactaccaccgctttcaaccgtaatggaaatatcttcgct
tactccgtcagctacgactggagcaagggttactccgccaacacccagcagactgtcaac
aaggtcatgctgcaccctatcggaccggatgagacaaagcccagaccgaacacgcgcaag
cgttga

DBGET integrated database retrieval system