KEGG   Penicillium chrysogenum: Pc16g09820Help
Entry
Pc16g09820        CDS       T01091                                 

Definition
Pc16g09820
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pcs  Penicillium chrysogenum
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Pc16g09820
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    Pc16g09820
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Pc16g09820
Protein phosphatases and associated proteins [BR:pcs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Pc16g09820
Transcription machinery [BR:pcs03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Pc16g09820
Spliceosome [BR:pcs03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Pc16g09820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MADQEVDLDSIIDRLLEVRGSRPGKQVQLLESEIRFLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVYGGMSAGGPVTPPRKQKKK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaggaagtggatctggactcgatcatcgaccggctcttggaggtgaggggt
agccgccctggaaagcaggttcagctgctcgagtcagagatccgtttcctctgcaccaag
gctcgtgagattttcatttctcagcccattcttctcgaactggaagcgcccatcaagatc
tgcggcgatatccatggccaatactatgacctcctgcgtctcttcgaatatggcggtttc
ccaccagaggctaactacctcttcctcggtgactacgtcgaccgtggcaagcagtccctc
gagaccatctgcctcctccttgcatacaagatcaagtaccctgaaaacttcttcattctg
cgtggaaaccacgagtgtgcctcgatcaaccgtatctacggtttctacgatgaatgcaag
cgccgatacaacatcaagctctggaagactttcaccgactgctttaactgcctccccatt
gccgccatcattgatgagaagatcttcactatgcacggtggtctgagcccggatctcaac
tcgatggagcagatccgccgtgtcatgcgccccacggatattcccgactgcggtctcctg
tgcgatctcctgtggtccgaccccgataaggatatcaccggctggagcgaaaacgaccga
ggtgtatcattcacgttcggccccgacgtggtctcgcgcttcctccaaaaacacgatatg
gatctgatctgccgtgcacaccaagttgttgaggatggatacgaattcttctccaagcgc
cagctggttacactattcagtgcgcccaactactgtggtgaattcgataatgccggtgca
atgatgagcgtggacgagagtctgctctgctccttccagatcttgaaaccagcggagaaa
aagcaaaagtacgtttacggtggcatgagcgccggcggtcccgtcactcctccgcgaaag
caaaagaagaaataa

DBGET integrated database retrieval system