KEGG   Penicillium chrysogenum: Pc16g09820Help
Entry
Pc16g09820        CDS       T01091                                 

Definition
Pc16g09820
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pcs  Penicillium chrysogenum
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:pcs03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pcs04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MADQEVDLDSIIDRLLEVRGSRPGKQVQLLESEIRFLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVYGGMSAGGPVTPPRKQKKK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaggaagtggatctggactcgatcatcgaccggctcttggaggtgaggggt
agccgccctggaaagcaggttcagctgctcgagtcagagatccgtttcctctgcaccaag
gctcgtgagattttcatttctcagcccattcttctcgaactggaagcgcccatcaagatc
tgcggcgatatccatggccaatactatgacctcctgcgtctcttcgaatatggcggtttc
ccaccagaggctaactacctcttcctcggtgactacgtcgaccgtggcaagcagtccctc
gagaccatctgcctcctccttgcatacaagatcaagtaccctgaaaacttcttcattctg
cgtggaaaccacgagtgtgcctcgatcaaccgtatctacggtttctacgatgaatgcaag
cgccgatacaacatcaagctctggaagactttcaccgactgctttaactgcctccccatt
gccgccatcattgatgagaagatcttcactatgcacggtggtctgagcccggatctcaac
tcgatggagcagatccgccgtgtcatgcgccccacggatattcccgactgcggtctcctg
tgcgatctcctgtggtccgaccccgataaggatatcaccggctggagcgaaaacgaccga
ggtgtatcattcacgttcggccccgacgtggtctcgcgcttcctccaaaaacacgatatg
gatctgatctgccgtgcacaccaagttgttgaggatggatacgaattcttctccaagcgc
cagctggttacactattcagtgcgcccaactactgtggtgaattcgataatgccggtgca
atgatgagcgtggacgagagtctgctctgctccttccagatcttgaaaccagcggagaaa
aagcaaaagtacgtttacggtggcatgagcgccggcggtcccgtcactcctccgcgaaag
caaaagaagaaataa

DBGET integrated database retrieval system