KEGG   Penicillium chrysogenum: Pc16g11400Help
Entry
Pc16g11400        CDS       T01091                                 

Definition
Pc16g11400
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pcs  Penicillium chrysogenum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pcs04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
LDKLSLEKGRPLDVDDLDDEGWHAASEQNMIVELGSLGEGAGGAVTRCRLKEGNTVFALK
IITTDPNPDVKKQIVRELNFNKDCASHHICRYYGAFMDKSTGTISIAMEFCEGGSLDSIY
KEVKKLGGRTGEKVLGKVAEGVLNGLTYLHSRKIIHRDIKPSNILLCRDGKVKLCDFGVS
GEFGTKGDANTFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGTEMQ
PRAGLIDLLTYIVRQPIPKLKDEPQNGIRWSDNFKYFIECCLEKEPPRRATPWRMLEHPW
VQDMRNKKVNMANFIKQVWDWKE
NT seq 821 nt NT seq  +upstreamnt  +downstreamnt
atgtcctactcctgttaccaactcagtgcccacctcgaagacgacaccatggatgccaca
ggcgcctgcgtttacgggcagcagtactacctcgtctatccggacggcgacgccgtccaa
tgtcacagcatgtgctacgaccatggcccttgccagaacgtatgcgccgacaacaaattc
tccatgcccccgggcctcgactccctcagcggtggcaacttcgacggcgtctccactgct
gatctgatcagggggtccgtccgcacgtggaagaaaaacggcaacgcaaacggcggtggc
ttcgcggacccgactaaccagggcacaatcgacaacaggatggacatggatgttacaaca
cctggatttatgaggatccccgtctgcagccccgagcgcgcctttcaatcctgggtcacg
gccaatccgggtccagcgacttctacccctgcgatattccaccaggtaaggacacctgcg
ggcactcgacttttgtggacgtaactagcaatgattagcctcttgtcgatgactgtctta
caatcattaagaacattgagggcgacgcaactacggactataccactcaggttctcggca
agaatcagcgcgagtttgtcgcgcatgcttcttgtcactttggtgtggaggctgccaagg
agggtgggaatgcggacatcgttgttggtgggcaggacgtcattgatattatcaaggagt
cggttaagcagtttgctagggatggcaaggttggagcaaaggacaacatggattgtaatg
gcaacattaaaggtcagccggtactgtgggggatttattag

DBGET integrated database retrieval system