KEGG   Penicillium chrysogenum: Pc16g13170Help
Entry
Pc16g13170        CDS       T01091                                 

Definition
Pc16g13170
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pc16g13170
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pc16g13170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 346 aa AA seqDB search
MVFIAFHGQDNSVANPVYSKIIQIPYSHFYQTGAPFDTGTSYRPGARFGPSGIRQGSRRL
NLGGYNVPLQANPFTSDMRILDCGDVPVTSYDNAWAIRQIEEGHNSILMRKPYLDANKPG
LSRAGKTLPRVITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDSWKPKVFGGSPSEVA
AINHGTYFYHAAMEGLLRNDTNIHAGIRTTLSGPSDYDNDGYCGFEIVEAREIDVIGTDG
IIKKIRDRVGTDNPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGLDGLNFIGA
DIVEVAPAYDTNAELSTMAAADVLYEVLTIMVKKGPLSIGEDSHEL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcattgcattccacggtcaagacaactcagtggcaaacccggtctacagcaag
atcatacaaatcccctattcacacttctaccaaacaggtgcccccttcgataccggaacc
tcctacagacccggcgcccggttcggacccagcggtatcagacaaggctctcgccgcctc
aatctcggtggctacaatgtgcctttgcaggcgaacccgtttactagcgatatgcggatc
ttggattgtggcgatgttcctgttacatcatacgacaacgcttgggcaatccggcaaatc
gaagaaggacacaacagcatcctgatgcgtaagccttaccttgacgcgaataaaccgggt
ctttcacgtgctggcaagacccttcctcgtgttattactctcggtggtgatcataccatc
acactgcccttgttgcggagtatcaataaggcatatgggcctgtgacggtgattcatttt
gatagtcatttggactcatggaaaccgaaggtcttcggtggctctcctagtgaggttgca
gctattaatcacggcacatacttctaccatgcggcgatggaaggattgttgaggaatgat
actaatattcatgccggtatccgtacgacactgtctggtccttcagattatgacaatgat
gggtactgcgggtttgagattgttgaggcgagagagatcgatgttattggaacggacggt
attatcaagaagattcgagaccgcgtcggaactgacaatccagtttacctctctattgac
attgatactctggatcctgctttcgcaccggctactggcacgccagagactggcgggtgg
tccacgcgcgaactgcgaacaatcatccgtggtcttgacgggttgaacttcattggtgca
gatatcgttgaggtcgcgccggcatacgataccaatgcagagttgtcgacgatggctgcc
gccgatgtgctatatgaggtccttactataatggtcaaaaagggtccattgtctattggg
gaggactctcatgagctgtga

DBGET integrated database retrieval system