KEGG   Penicillium chrysogenum: Pc16g14140Help
Entry
Pc16g14140        CDS       T01091                                 

Definition
Pc16g14140
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
pcs  Penicillium chrysogenum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcs01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pcs00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 870 aa AA seqDB search
MATPFLISHDPSSSPASDSGLSLKQIAYFGRVLIKVSSLAQAEQFLRQNFRTLDVFVDAT
EISSAGDLVDILNAGAAKILINLDQLTTLSEEQSVPSSRLLVNALSDSELDTFQQWIAAN
AERSEASVCTSPSTISAAAEKLKISSDSPRLFTTFSTQTLSEDAITQVTKQGAIAVVPSQ
ALTVERDVAGQISAAKLIASTAVTDQANGLYATSVTDERGACLGFVWSSDESIVEALRTG
TGVYQSRKRGLWYKGQSSGDVQELIRIGFDCDADCLVFVVKQIGRGFCHLGTETCFGASS
GLSRLQKTLDARKADAPAGSYTARLFNEPKLIDAKIMEEADELCRAKTKEEVAFEAADLF
YFALTKCTAAGVSLEDIERNLDLKSLKVKRRKGDAKGPWAEKAGLAKPESKPAPAPAPAP
VEDLTSRIEMKRVITASTTPQVVSEYLKRPSQKSNEAIVNLVKPIIQDVRDGGDAAVLKY
THKFEKATSLTSPVIHAPFPAELMKLSPDVQEAIDISIGNIDRFHSAQKGSNDALQMETM
PGVVCSRFSRPIERVGLYIPGGTAVLPSTAMMLGVPAMVAGCNKIVLASPPRSDGSISPE
IVYVAHKVGAESIVLAGGAQAVAAMAYGTESITKVDKILGPGNQFVTAAKMFVSNDTSAG
VSIDMPAGPSEVLVIADKTAVPAFVASDLLSQAEHGVDSQVILIAVDLNEAELRAIEDEV
DAQAKALPRMDIVRGSLAHSITFVVRDINEAMALSNDYAPEHLILQVENPESVVKDVKNA
GSVFIGAWTPESVGDYSAGVNHSLPTYGYAKQYSGVNLGSFLKHITSSNLTADGLLGLSK
TVETLAAVEGLEAHKRAVSIRVAHMKKSQS
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccgttccttatctcccacgacccctcctcctcccccgcctccgactccgga
ctttcgctcaagcagatcgcctacttcggccgcgtactgatcaaggtctcgagtctcgct
caggcagagcaattcctgcgccagaatttccgcaccctcgatgtcttcgtcgacgcaact
gaaatctcctccgccggtgatctcgtcgatatcctgaacgctggtgccgccaagatcttg
atcaacctggaccaattgaccaccctctccgaagaacagtccgtgccctcgtcccgtttg
cttgtcaacgccctgtcagactccgaattggatactttccagcaatggattgctgccaat
gccgagcgcagcgaagctagcgtctgcacttcaccctccaccatctccgccgccgccgag
aaattgaagattagctcggactccccacggctcttcacaaccttcagtactcagacattg
tcggaggatgctattacacaagttacaaagcagggtgcgattgctgtcgttccctcacag
gcattgaccgttgagcgggatgtggctggccagatctctgccgctaagcttattgcgtcg
accgctgttactgaccaggccaatggtctatatgccacttcggtcactgatgagcgggga
gcctgtctgggctttgtgtggagcagcgacgagagcattgttgaggccttgcgtactggc
accggtgtctaccaaagccggaagcgcggtctttggtacaagggccagtccagcggcgat
gtacaggagttgatccgcattggcttcgactgtgatgccgactgtttggtctttgttgtg
aagcaaataggacgtggattctgccaccttggtactgaaacctgcttcggtgcatcttct
ggtctgtctcgtctccagaagactttggacgcccgcaaggcggatgctccggctggatca
tacaccgcgcgtttattcaatgagcccaagctcatcgatgctaagatcatggaggaggct
gatgagctgtgccgtgccaagaccaaggaggaggttgctttcgaggccgccgacctgttt
tactttgccctgaccaagtgcactgctgccggtgttagcctggaggatatcgagcgcaac
cttgacctcaagagcttgaaggtgaagcgtagaaagggtgacgctaagggaccttgggct
gagaaggctggtctggccaagcccgagtcaaagcctgctcctgctcccgcgcccgccccg
gttgaggatctcacatcccgaatcgaaatgaagcgtgttatcaccgcctccactactccc
caggtggtcagcgagtaccttaagcgtccttcccagaaatctaacgaagccattgtcaac
ctggtgaagccaatcatccaggatgtccgcgatggcggcgacgctgcagttctcaaatac
acccacaagttcgagaaggctacatcactcacctcccccgttatccacgcgccattcccc
gctgagctcatgaagctgtcccccgatgtccaggaggcaattgatatcagcattggaaat
atcgaccgcttccactccgcacagaagggaagcaacgacgccctccagatggagaccatg
cccggtgtggtctgctctcgcttctcgcgccccattgagcgggttggtttgtacatcccc
ggtggtacagctgtgctgccctccactgccatgatgctgggtgttcccgccatggtggca
ggctgcaacaagattgtccttgcctcacctccccgctcggacggcagcatctcccccgaa
atcgtatacgtcgcccacaaggtcggcgctgagagcatcgtgctggccggtggtgctcag
gccgtggccgccatggcctacggcaccgagagcattactaaggtcgacaagatccttggt
cccggcaaccagttcgtgacggccgcaaagatgttcgtgtccaacgatacatccgcaggc
gtcagcatcgacatgcccgccggccccagtgaagtcctcgtgatcgccgacaaaaccgcc
gtcccggcctttgttgcatctgaccttctcagtcaggccgagcacggtgttgactcacag
gtgatcctcatcgccgttgacttgaacgaggccgagcttcgtgccattgaagacgaggtc
gatgcccaggccaaggccttgccccgtatggatatcgtccgcggctccctcgcgcactcg
atcaccttcgtcgtacgggacatcaacgaggcgatggcccttagcaacgactacgcgccc
gagcacctgatcctgcaggtcgagaaccccgagtctgttgtcaaggatgtcaagaacgcc
ggcagtgtcttcatcggcgcctggactcccgagagtgttggcgattactccgccggagtc
aaccactcgctgcctacctacggctacgccaagcagtattcgggtgtcaacctcggctcc
ttccttaagcacatcacgagctctaacctgaccgccgatggcctgctcggtctctccaag
acggttgagaccctcgctgctgtggaaggcttggaggcgcacaagcgtgccgtcagcatc
cgtgttgcccacatgaagaagagccagtcatag

DBGET integrated database retrieval system