KEGG   Penicillium chrysogenum: Pc18g01230Help
Entry
Pc18g01230        CDS       T01091                                 

Definition
Pc18g01230
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 619 aa AA seqDB search
MQEKPTTVAAYAAGASLAAVALFYVFGPNYTIDGDESNDSNRKKSIVGLSNLANDCFINS
VLQALAGLGDLRVYLIHELHRRELDGPEIYHTLPSEDGLSPARSDKLRELQQGITTRALK
EMLDRLNERPIYKKTISARDFIQALEYAFRTRISRNQQDAQEFLQIVLERLCDEYHAGAR
ARQRALGTMGAAGSSSAGEEGSAQESSSEVEVRIDDGSANGLPAIIDTKLKEIDQESGFP
FEGKMESQIECQFCHYQYKPNQTAFVNLTLQVPQKSSTTLNSCFDGLLKTEYIEDFRCDR
CRLQHAVEAKTTELTRARIQGDRDRLDQEISRLREALETDPEAELEGIVFPPSETAPKRR
IARHMRITAFPKVIAIHLSRSIFDQSSSSKNAAKVSFPERLPLGSILSQKWYKLLAIVCH
KGSHHSGHYESFRRNHIYPPFSTPEVFSSYAQSRTASQSPSAAPSPRIVPRSSPDVEGDA
SISRAGSSTSLSGASATQLTPPQPRPTTSGSRRSFQSTTSRSSKQALSPVSGSNSPTTDQ
GRWSPAAPRPSHSIPRPSQDTPTVSSRLRRRRKPNDRWWRISDEKIKECKTSDVLGMQRE
VYLLFYELEKPDASPTMGR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaagccgacaacggtcgccgcctatgcggccggggcctcactcgctgccgtt
gctctgttctatgtctttgggccgaactacacaattgacggagatgagtcaaacgacagc
aatcgcaaaaagagcatcgtgggcctgtccaacctggccaatgactgctttatcaattcg
gtactgcaggcattggccgggttgggggatctgcgagtctacctgatccacgagctgcac
cggcgcgagctggatggaccggaaatataccatacactgccgagcgaggatggactttcg
ccggcgcggtcggacaagttgcgggagttgcaacaggggataaccacacgggcattgaag
gagatgttggaccgcttgaacgagcgtccgatctataaaaagacaatctcggcccgtgac
ttcatccaggctctggaatacgcgtttcgtacacgcatcagccgcaatcagcaggacgcg
caggaattcctgcagattgttctcgagcgactttgtgatgagtaccatgctggtgcacgc
gcgcgtcaacgagcactgggtaccatgggtgcagctggttccagctcggcgggtgaagag
ggcagcgcacaagaaagctcatccgaggtggaggtgcgcatcgatgatggatcggccaac
ggactacccgccatcattgacacgaaactgaaggaaatcgaccaagagtccgggttcccg
ttcgaaggcaaaatggagtcgcagatcgagtgccagttctgtcattaccaatacaagcca
aaccagacggctttcgtcaacttgacactacaggtgccgcagaagagctcgactacgctc
aactcgtgcttcgacggtctcctcaagactgaatatatcgaggatttccgttgcgaccga
tgccgcctgcagcatgctgtggaggccaagaccaccgagctaacccgtgcccgaatacag
ggtgatcgagatcggttggaccaggagatttcacgcctccgcgaggctctcgagacggac
cctgaggccgagttggagggtattgtattccctccgtcagagaccgccccgaagcgcaga
attgcgcggcatatgcgcatcacggcgttcccaaaggtcatcgccatccacttgtcgcgg
tcgatcttcgaccaaagcagttcgagcaagaacgcggccaaggtctcattcccggagagg
ctccctttgggaagcatcttgagccagaaatggtacaagctacttgcgattgtctgccac
aaaggtagccaccatagcgggcactacgagtccttccggcggaatcatatctacccgccg
ttctcgacgcccgaggtcttcagttcctacgcgcagagtcgcactgctagtcagagcccc
tccgcggcgccaagtccccggatcgtaccacgcagcagtccggatgtcgagggcgacgca
agcatttccagagctggctcgtcaacctcgctatctggagcttcagctacccaacttacc
cctcctcaaccacggcctacaacctctggctcgcgtcgttctttccagagcaccacctcg
cgttcctccaaacaggcgttgtcgcccgtctctggtagcaacagtccgacgacggaccag
ggtcgctggagtccggctgccccgcgtccctcccacagcataccccgcccttcccaggat
acccccactgtcagttcgcgacttcggcgccgtcgcaaaccgaacgatcgctggtggcgc
atctcggacgagaagatcaaggaatgtaagacctcagacgtgctgggcatgcagagggag
gtctacctcttgttctatgagttggagaagcctgatgcgagccctaccatgggacgttga

DBGET integrated database retrieval system