KEGG   Penicillium chrysogenum: Pc18g01230Help
Entry
Pc18g01230        CDS       T01091                                 

Definition
Pc18g01230
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Pc18g01230
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Pc18g01230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 619 aa AA seqDB search
MQEKPTTVAAYAAGASLAAVALFYVFGPNYTIDGDESNDSNRKKSIVGLSNLANDCFINS
VLQALAGLGDLRVYLIHELHRRELDGPEIYHTLPSEDGLSPARSDKLRELQQGITTRALK
EMLDRLNERPIYKKTISARDFIQALEYAFRTRISRNQQDAQEFLQIVLERLCDEYHAGAR
ARQRALGTMGAAGSSSAGEEGSAQESSSEVEVRIDDGSANGLPAIIDTKLKEIDQESGFP
FEGKMESQIECQFCHYQYKPNQTAFVNLTLQVPQKSSTTLNSCFDGLLKTEYIEDFRCDR
CRLQHAVEAKTTELTRARIQGDRDRLDQEISRLREALETDPEAELEGIVFPPSETAPKRR
IARHMRITAFPKVIAIHLSRSIFDQSSSSKNAAKVSFPERLPLGSILSQKWYKLLAIVCH
KGSHHSGHYESFRRNHIYPPFSTPEVFSSYAQSRTASQSPSAAPSPRIVPRSSPDVEGDA
SISRAGSSTSLSGASATQLTPPQPRPTTSGSRRSFQSTTSRSSKQALSPVSGSNSPTTDQ
GRWSPAAPRPSHSIPRPSQDTPTVSSRLRRRRKPNDRWWRISDEKIKECKTSDVLGMQRE
VYLLFYELEKPDASPTMGR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaagccgacaacggtcgccgcctatgcggccggggcctcactcgctgccgtt
gctctgttctatgtctttgggccgaactacacaattgacggagatgagtcaaacgacagc
aatcgcaaaaagagcatcgtgggcctgtccaacctggccaatgactgctttatcaattcg
gtactgcaggcattggccgggttgggggatctgcgagtctacctgatccacgagctgcac
cggcgcgagctggatggaccggaaatataccatacactgccgagcgaggatggactttcg
ccggcgcggtcggacaagttgcgggagttgcaacaggggataaccacacgggcattgaag
gagatgttggaccgcttgaacgagcgtccgatctataaaaagacaatctcggcccgtgac
ttcatccaggctctggaatacgcgtttcgtacacgcatcagccgcaatcagcaggacgcg
caggaattcctgcagattgttctcgagcgactttgtgatgagtaccatgctggtgcacgc
gcgcgtcaacgagcactgggtaccatgggtgcagctggttccagctcggcgggtgaagag
ggcagcgcacaagaaagctcatccgaggtggaggtgcgcatcgatgatggatcggccaac
ggactacccgccatcattgacacgaaactgaaggaaatcgaccaagagtccgggttcccg
ttcgaaggcaaaatggagtcgcagatcgagtgccagttctgtcattaccaatacaagcca
aaccagacggctttcgtcaacttgacactacaggtgccgcagaagagctcgactacgctc
aactcgtgcttcgacggtctcctcaagactgaatatatcgaggatttccgttgcgaccga
tgccgcctgcagcatgctgtggaggccaagaccaccgagctaacccgtgcccgaatacag
ggtgatcgagatcggttggaccaggagatttcacgcctccgcgaggctctcgagacggac
cctgaggccgagttggagggtattgtattccctccgtcagagaccgccccgaagcgcaga
attgcgcggcatatgcgcatcacggcgttcccaaaggtcatcgccatccacttgtcgcgg
tcgatcttcgaccaaagcagttcgagcaagaacgcggccaaggtctcattcccggagagg
ctccctttgggaagcatcttgagccagaaatggtacaagctacttgcgattgtctgccac
aaaggtagccaccatagcgggcactacgagtccttccggcggaatcatatctacccgccg
ttctcgacgcccgaggtcttcagttcctacgcgcagagtcgcactgctagtcagagcccc
tccgcggcgccaagtccccggatcgtaccacgcagcagtccggatgtcgagggcgacgca
agcatttccagagctggctcgtcaacctcgctatctggagcttcagctacccaacttacc
cctcctcaaccacggcctacaacctctggctcgcgtcgttctttccagagcaccacctcg
cgttcctccaaacaggcgttgtcgcccgtctctggtagcaacagtccgacgacggaccag
ggtcgctggagtccggctgccccgcgtccctcccacagcataccccgcccttcccaggat
acccccactgtcagttcgcgacttcggcgccgtcgcaaaccgaacgatcgctggtggcgc
atctcggacgagaagatcaaggaatgtaagacctcagacgtgctgggcatgcagagggag
gtctacctcttgttctatgagttggagaagcctgatgcgagccctaccatgggacgttga

DBGET integrated database retrieval system