KEGG   Penicillium chrysogenum: Pc18g01310Help
Entry
Pc18g01310        CDS       T01091                                 

Definition
Pc18g01310
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pcs  Penicillium chrysogenum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pc18g01310
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Pc18g01310
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pc18g01310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 852 aa AA seqDB search
MAYLDLQKQVGQLFAVGFHGCTPSPEIKTLIHDYHVGGIVLFSRNFQNAEQLQALTLALQ
NEAKSAGHERPLLIGIDQENGLVTRISPPIAAQVPGPMALGATHDPECAYSAGKATGETL
SFFGINMNYAPVCDINSEPLNPVIGVRSPGDDPEFVGRFASAAARGLREHNIIPSVKHFP
GHGDTAVDSHYGLPVIPKTRDQLERCELIPFRRAVAEGIETVMTAHISLPCIDLTRPATL
SPDVMGILRKDMAYDGMIITDCLEMDGIRSTYGTEEGSVLALRAGSDSIMICHTFDVQVA
SIKRVCEAIKSGTIDQARLADACRHVSTVKDKFLSWDAALRQSSLAGLSSLNNRIAETTM
DIYSRSTTLVRDKNSVLPLSKTSIIIFLFPGDKTPVGGAVDGEGTGRSGLYQSSKYLDVL
RQHNNSIAELRYGASGLTSEQWRSLEVADVVIFTSLNAKESPYQESLGLKLAERVRSLVH
IAACNPYDFLDAPSVKTYITTYEPTIEAFSVAADIMFGALVPTGALPVGTNALTKTSAVV
IPFDAQRDLDEVVEVWAAALPTYLVPNESLRSMIVCPHGHHFIARIGSQVVGFCLAYTDA
QSAPSTVYIAVLAVSPRYQHQGIGISLLEETRAYFRATFGFNNVKLGSSFPRFWPGIPQD
LPESVQHFFTHRGFRLSPPSARSVDLYQDIRNFQSPEKYITRARERGFRFAPLKSEDYEA
CLVGQRKNFSNNRSWVEAYVTLHPDKYPDSVMTAFDSQGQQVGWTLMLGPSDALNTSWAF
PQTCGPNTGLIGAVGIDESHRKYGIGLALICHAIEAMKQRGIEGVFVDWVALDGWYEQVG
FKTWRSYRPGEL
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggcttatttagatcttcaaaaacaggttggccagctcttcgcggtggggtttcatggc
tgcaccccaagtcccgaaatcaagactttgatccatgactaccacgttggaggcatcgtc
ctcttctcacgtaattttcagaatgcagaacagcttcaggccttgacactggctttacag
aatgaagccaaatcagctggacatgagcgaccactgttgatcggaattgatcaggagaat
ggactggtcactcgaatttctcccccgatcgctgctcaggtaccaggccctatggcactc
ggcgccacgcatgacccagaatgcgcctacagtgcggggaaagccacgggggaaaccctc
agtttcttcgggattaacatgaactacgcaccagtgtgcgatatcaactcggagcctcta
aatcctgttattggtgtacgcagccctggcgatgaccctgaattcgtgggtcgatttgcg
agtgcggctgcgcggggtctgcgggaacataacatcatccccagtgtaaagcattttcca
ggtcatggtgacacggctgttgactcacattatggattaccagtaatccccaaaacgagg
gaccagctggagcgttgcgagttgattccctttagacgggctgtcgctgaaggcatcgaa
acagtcatgacagctcatatctcactgccctgtatcgatcttacgcggcctgcaacactt
tctcctgatgtcatgggaatcttgcgcaaggacatggcctatgatggtatgataatcaca
gactgtctggagatggatggaatccgctccacatacgggacagaggaaggctcggtgcta
gcgttgcgcgctggtagcgatagcatcatgatctgtcataccttcgatgtgcaggtggct
tcgatcaagagagtctgtgaagcaataaagtccggcacgatcgatcaagcacgattggca
gatgcttgtcgccatgtctctacagtgaaggacaagtttttgagctgggacgctgctctt
cggcaatccagtctcgcaggcctgagctcgctcaacaatagaattgccgaaacgactatg
gatatatattcccggtcgaccacactcgttcgtgacaagaatagtgttctccccctgtca
aaaacttcaatcatcatcttcctcttccccggagacaagaccccagtcggtggtgctgtt
gacggcgaagggacagggaggtcaggattatatcagtccagcaaatatcttgatgtgctg
cggcagcataacaattccatcgccgagctcagatacggagcgagtggtctgacttcggag
caatggcgatcccttgaagtcgccgatgtggtgattttcacttcgctcaatgcaaaggag
tcgccataccaggagtcactagggctgaaacttgctgaacgtgttcgttcattggtccat
attgctgcctgtaacccttatgacttccttgatgctcctagtgttaagacttatatcacc
acatacgagccgactatcgaggcattttctgtggctgccgatatcatgttcggagcacta
gtcccgacgggcgctcttcccgtgggaactaatgctttgacaaagacctccgcggtagta
ataccatttgacgcacaaagagatctggatgaagtggtcgaagtctgggcggcagctctc
ccgacctacctcgtgcctaacgaaagtttgcggtctatgatagtatgccctcatggccac
catttcatcgcgcgcattgggtcgcaggtagtaggcttctgtttggcctacacagatgcc
caaagtgcaccaagcaccgtgtatatcgcagttcttgccgtgtcaccaagatatcaacac
caaggcattggaatttccctgctagaagaaacgagagcatacttccgggcaacctttggc
ttcaataatgtgaagctgggaagctcatttccccgattttggcccggtataccccaggac
cttccagaatcagtgcagcatttcttcactcaccgaggtttccgactcagtcctcccagt
gcccggtcggttgatttgtaccaggatattcggaacttccagtcgccagagaagtatatc
actcgtgcccgggagcgaggcttccgcttcgcgccattaaaatccgaagattacgaggcc
tgtctagttggccaaagaaagaacttctcgaataataggagctgggtggaggcatacgtc
acattacatcccgacaagtatccggatagtgtgatgacagcgttcgactcccaaggccag
caggtcggctggacgttaatgctcggtccatcggatgctctaaacacgtcttgggcattc
ccccaaacctgcggtcctaacacagggctgattggtgccgtgggaattgacgagtcccac
cggaagtatggtattgggttggcattaatctgtcacgcgattgaagccatgaagcaacga
ggcattgaaggcgtcttcgtagactgggttgcactcgacgggtggtatgagcaggttggt
tttaagacttggcgaagctacagacccggagaactttga

DBGET integrated database retrieval system