KEGG   Penicillium chrysogenum: Pc18g01780Help
Entry
Pc18g01780        CDS       T01091                                 

Definition
Pc18g01780
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pcs  Penicillium chrysogenum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pcs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pcs00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 189 aa AA seqDB search
MSSATSFFDFEPVDKKGAPFPLSSLNGKVVLVVNTASKCGFTPQFEGLEKLYQELKAQYP
EDFTIVGFPCNQFGSQDPGSDDEIQSFCQLNYGVTFPVLGKLDVNGDNAAPVWTFLKEQQ
PGIMGMKRVKWNFEKFLVSADGKAVNRWASLTKPEGLKDTIVKEIEKAKKEGTLASLKSE
AGAEQAKLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctacatctttcttcgattttgagcctgtcgacaaaaagggtgcccccttc
cccctttcttcgctgaacggcaaagtcgtgctagtcgtgaacacagcctcaaaatgcggc
ttcacgccccagtttgaaggcctggagaaactctaccaggagctgaaggcccagtacccc
gaagacttcaccatcgtcggattcccatgcaaccagttcggcagccaggaccctggctct
gacgatgagatccagtccttctgccagctcaactacggcgtcaccttccccgtgctcgga
aaactggatgtgaacggcgataacgctgcacctgtgtggactttcctgaaggaacagcag
cctgggatcatgggcatgaagcgcgtcaagtggaactttgagaagttcctcgtctccgcc
gatggaaaggctgttaaccgctgggcttctcttaccaagcccgagggacttaaggatacc
attgttaaggagatcgagaaggcgaagaaggagggcactcttgcttcgctgaagagtgag
gctggtgctgagcaggctaagctgtcgtag

DBGET integrated database retrieval system