KEGG   Penicillium chrysogenum: Pc18g01780Help
Entry
Pc18g01780        CDS       T01091                                 

Definition
Pc18g01780
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pcs  Penicillium chrysogenum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pc18g01780
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pc18g01780
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pc18g01780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 189 aa AA seqDB search
MSSATSFFDFEPVDKKGAPFPLSSLNGKVVLVVNTASKCGFTPQFEGLEKLYQELKAQYP
EDFTIVGFPCNQFGSQDPGSDDEIQSFCQLNYGVTFPVLGKLDVNGDNAAPVWTFLKEQQ
PGIMGMKRVKWNFEKFLVSADGKAVNRWASLTKPEGLKDTIVKEIEKAKKEGTLASLKSE
AGAEQAKLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctacatctttcttcgattttgagcctgtcgacaaaaagggtgcccccttc
cccctttcttcgctgaacggcaaagtcgtgctagtcgtgaacacagcctcaaaatgcggc
ttcacgccccagtttgaaggcctggagaaactctaccaggagctgaaggcccagtacccc
gaagacttcaccatcgtcggattcccatgcaaccagttcggcagccaggaccctggctct
gacgatgagatccagtccttctgccagctcaactacggcgtcaccttccccgtgctcgga
aaactggatgtgaacggcgataacgctgcacctgtgtggactttcctgaaggaacagcag
cctgggatcatgggcatgaagcgcgtcaagtggaactttgagaagttcctcgtctccgcc
gatggaaaggctgttaaccgctgggcttctcttaccaagcccgagggacttaaggatacc
attgttaaggagatcgagaaggcgaagaaggagggcactcttgcttcgctgaagagtgag
gctggtgctgagcaggctaagctgtcgtag

DBGET integrated database retrieval system