KEGG   Penicillium chrysogenum: Pc18g02000Help
Entry
Pc18g02000        CDS       T01091                                 

Definition
Pc18g02000
Orthology
K00222  
delta14-sterol reductase [EC:1.3.1.70]
Organism
pcs  Penicillium chrysogenum
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:pcs00100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MAEKHSKKIPVQPVPEKRGYEFGGPLGAFGIVFGLPILIYVFTFVCNDISGCPAPSLLNP
STLSLEQLKREAGWPDQGVTALYDTNVTLWTLSYYAFSLFLQVFLPGQEADGVVLACGGR
LKYKFNAFPSAIIILSGLAGGTYLYGADFVVWTFLWDNYVQVITANILISSFIALFVYTK
SFTVPAPGQATPSLRQLAPGGHTGNMLYDFFIGRELNPRVCLPIPFVSEASRTIDIKVFM
EMRPGLLGWTILNLSNVAHQYRTYGYITDSIVLVTVFQAFYILDALYMEPAIMTTMDVIM
DGFGFMLSFGDVVWVPHVYSIQTRYLSVFPYELGLSGMAVVLGITAVGYLIFRGANNQKN
RFRTDPNDPRVKNIKYIETAAGSKLMISGWWGLARHINYLGDWTMSWAYCLPTGVAGYVL
IESINPASGIVQKQAVQTPEVRGWGMIFTYFYMLYFGILLIHREMRDEEKCEKKYGADWK
RYTSIVRSRIIPGIY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcattccaaaaaaatacccgtgcagccagtgccggagaaacgcggttat
gagtttggtggaccactaggtgctttcggtatcgtgtttggactgccaatcctgatttat
gtcttcacctttgtctgcaacgatatctctggttgtcctgcaccatcgttgctgaacccc
tcaactttgtcgctcgagcaattgaagcgtgaagcgggttggccagaccagggagtcacg
gcgctttatgacaccaatgttacactgtggacactgagctactatgccttcagcctgttc
ttgcaggtcttccttcccggtcaggaggcagacggtgttgtgttggcctgcggaggacgg
ctgaagtacaaattcaatgcattcccctctgccatcattatcctctcgggcctcgccggg
ggtacctatctctacggagccgactttgtggtgtggacattcctatgggacaactatgtt
caggtcattacagcaaacatattgatctcttcttttatcgcgctgtttgtctacacgaag
agcttcacagttccagccccgggccaggcaaccccaagcctacgacagctggcacctggc
ggccatacgggcaacatgctctacgacttcttcatcggccgtgagctcaacccccgtgtt
tgcctgcccattccatttgtcagtgaggcatcgcgcaccattgatatcaaggtgtttatg
gagatgaggccaggcttgcttgggtggacaatcctgaacctgtccaatgtggcccaccag
taccgaacctatggctacatcactgactcgatcgtgctggtcaccgtcttccaggcattc
tacatcctggatgcgctatacatggaaccggcaatcatgactaccatggacgtaatcatg
gacggattcggattcatgttgtctttcggcgatgtggtttgggtgcctcatgtgtacagc
atccagacccgatatctctctgtcttcccttacgagcttggcttgagcggtatggctgtt
gttctgggtatcacagccgtcggatatttgatcttccgcggcgccaataaccagaagaac
cgtttccgcacggatccaaatgacccccgcgtgaagaacatcaagtacatcgaaactgct
gctggatccaaactgatgatctccggctggtggggtctcgcgcgtcacatcaactacctg
ggcgactggaccatgtcgtgggcgtactgtctgccaactggtgtcgcgggatatgttctc
attgagagcatcaacccagccagtggcattgtccagaagcaagccgtgcagaccccagaa
gtccgtggctggggtatgatcttcacgtacttctacatgctctacttcggtatcttgttg
atccaccgtgagatgcgtgatgaggaaaagtgcgagaagaagtacggtgctgactggaag
cgttatacctccatcgtccgcagccgtatcatccctgggatctactga

DBGET integrated database retrieval system