KEGG   Penicillium chrysogenum: Pc18g02900Help
Entry
Pc18g02900        CDS       T01091                                 

Gene name
plb1
Definition
lysophospholipase phospholipase B plb1-Penicillium chrysogenum
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pc18g02900 (plb1)
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pc18g02900 (plb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 638 aa AA seqDB search
MKTFALISIALGLPGAIAVPGALDTDDITFAGVQRALPNAPDGYVPTSVSCPASRPTVRS
AAKLSTNETSWLEVRRGKTLSALKDFFGHVKVGDYDVGAYLDKHSGNSSSLPNIGIAVSG
GGWRALMNGAGAVKAFDSRTDNATATGHLGGLLQSATYISGLSGGSWLLGSIYINNFTTV
DKLQTHEAGSVWQFGNSIIEGPDAGGIQLLDSAGYYKDLADAVDGKKKAGFDTTLTDIWG
RALSYQMFNASNGGLSYTWSSIADTPEFQDGDYPMPFVVADGRNPGELVIGSNSTVYEFN
PWEFGTFDPTIFGFVPLEYLGSKFEGGSLPSNESCIRGFDSAGFVIGTSSSLFNQFLLQI
NTTSLPSFIKDVFNGILFDLDKSQNDIASYDPNPFYKYNEHSSPYAAQKLLDVVDGGEDG
QNVPLHPLIQPERHVDVIFAVDSSADTDYFWPNGTSLVATYERSLNSSGIANGTAFPAVP
DQNTFINLGLSTRPSFFGCDSSNQTGPSPLVVYIPNAPYSYHSNISTFQLSTDDAERDNI
ILNGYEVATMANSTLDDNWTACVGCAILSRSFERTGTTLPDICSQCFDRYCWNGTVNSTR
PESYDPAFYLADNSMASVSLPTMLSTVVAAGLAMLILV
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttttgcgctgatctcgattgctctgggcttgcccggcgcaatcgctgttcct
ggcgcgctcgataccgatgatatcacattcgcaggtgtgcaacgagccctccccaatgcg
cccgacgggtacgtgccgacatccgtcagctgcccggcgagccgaccgacagttcgcagc
gcagcgaagctgtccacgaacgagacatcatggctagaagttcgccgcggcaagaccctg
tcggcgctgaaggatttcttcggacatgtgaaagtcggcgattatgacgtcggcgcctac
ctcgataaacactccggcaactcgtcgagtctgccgaatatcggtattgccgtttcaggc
ggtgggtggcgtgcgttgatgaacggtgccggcgcagtcaaggctttcgatagccggacg
gacaatgcgacggcgacggggcatttgggtggtctgctgcagtctgctacctatatttct
ggtctgagtggaggtagctggttgctgggttcaatctacatcaataacttcactacggtc
gacaagctgcagacgcacgaggctggttctgtctggcaatttggaaactcgatcatcgag
ggtcctgatgctggtggtattcagcttttggattctgccggttactacaaggatctcgcc
gatgctgtcgacgggaagaagaaggctggctttgatactactctcaccgatatctggggc
cgcgcactctcctatcaaatgttcaatgctagcaatggtggactcagctatacctggtct
tccattgctgacacccccgaattccaggatggagactaccctatgccgtttgttgttgct
gatggccgtaaccccggtgagctagtcattggcagcaactcgaccgtgtatgagttcaac
ccgtgggagttcggcacttttgaccctactatctttggtttcgttcccctcgagtacctg
ggctctaagttcgagggtggctcgcttccgagcaacgagagctgcatccgcggttttgac
agtgctggctttgtgatcggaacctcctcttcgctcttcaaccagttccttctccagatc
aacaccacttcgcttcccagcttcataaaggatgttttcaacggcatcttgttcgatcta
gacaaatcgcaaaacgacatcgcttcgtacgatcccaaccccttctataaatacaacgag
cactcgtcgccgtacgccgcacaaaaattgctggacgtcgtcgatggcggcgaggatgga
cagaacgtccccttgcaccccctcatccagcccgagcgccatgtcgatgtcatcttcgcc
gttgactcttcagccgacactgactatttctggccaaacggcacctccctggttgcgacc
tacgagcgcagcctgaatagcagcggtatcgccaacggcaccgccttccctgcggttcca
gaccagaacaccttcattaacctgggcctcagcacccgcccgtccttctttggctgtgat
agttccaaccagaccggtccctcgcctctcgttgtgtacattcccaatgccccttactcc
taccactccaacatctcaaccttccaactaagcaccgacgacgctgagcgtgacaatata
attctcaatggctacgaggttgccacaatggccaacagcaccctcgacgacaactggact
gcctgtgttggctgcgctatcctcagccgctcgttcgagcgcacgggtaccactctcccg
gatatctgcagccagtgtttcgaccggtactgctggaacggcactgtgaactccaccaga
ccggaatcctatgatccagcgttttacctggctgataatagtatggcctcagtgagtttg
cccaccatgctttcaacggttgtcgcagccggtctggcgatgctcatcctggtataa

DBGET integrated database retrieval system