KEGG   Penicillium chrysogenum: Pc18g03000Help
Entry
Pc18g03000        CDS       T01091                                 

Definition
Pc18g03000
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc18g03000
Enzymes [BR:pcs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pc18g03000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MDRSNKPSAIGVGASLPQPTLSIKDNVVEASLPTGQSVAVHLYGATVTSWKTGGQEQLFV
SETAHLDGSKPIRGGIPVVFPVFGPPPQNHATSSLPQHGFARNSNWEFLGKSSSEAPGRD
SDQTDLTVKLDFGLSHSMLTDEFRAAWPYEFGLVYSVTLTTNSLETALQVRNEGQQNFEF
KVLMHTYLSIADISDIRVKGLESKTYVDKTLQGTSHTESSPALAITQETDRVYQQLDPAV
PIVVASAKDDQPLFSITREALTDVVVWNPWIEKAKGMADFGPDEAYKNMICVEAGSVSAW
QTLEAGEAWEGGQSIKSRL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatcaaacaagccctccgcaattggtgtgggagcttcccttccccagcccacc
ctctctatcaaggacaacgtcgtcgaagcttcgttgcccaccggccagtcagtggccgtg
cacctgtacggcgctactgtgacctcgtggaagaccggcggccaggagcagctgttcgtc
agtgagacagctcatctggatggctccaagcctatccggggtggcattccggtggtgttt
ccagtcttcggtcctccgccccagaaccacgctacctcatccctaccacaacatggcttc
gctcgcaactccaactgggagttcttgggcaagtcctcttcggaagcgcccggaagggat
agcgaccaaaccgatcttaccgtgaagttggatttcgggctgtcgcactctatgctgacc
gatgagttccgcgccgcttggccatatgagttcggtctggtgtacagtgttacgctcacc
acgaactcgctggagacggcactgcaggttcgcaatgagggccagcagaactttgagttc
aaggtgcttatgcacacatatctgagcattgcggatatctccgacatccgtgttaagggt
ctcgaatccaagacatacgtcgataagaccctccaaggaacttctcacaccgaatcgagc
cccgcattggccatcacccaagaaaccgatcgcgtctaccaacaacttgaccctgccgtt
cccatcgtcgttgcctctgcgaaggatgaccaacctttgttctcgatcactcgggaagct
ctgactgatgttgtggtctggaacccttggatcgagaaggccaagggcatggccgatttc
ggcccagacgaagcttacaagaacatgatctgtgtggaggctggctcagtgtctgcttgg
caaacgcttgaagctggagaggcctgggaaggtggacagagcatcaagtcgcgactatga

  All links  
No link information was found.   
DBGET integrated database retrieval system