KEGG   Penicillium chrysogenum: Pc18g03000Help
Entry
Pc18g03000        CDS       T01091                                 

Definition
Pc18g03000
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcs00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MDRSNKPSAIGVGASLPQPTLSIKDNVVEASLPTGQSVAVHLYGATVTSWKTGGQEQLFV
SETAHLDGSKPIRGGIPVVFPVFGPPPQNHATSSLPQHGFARNSNWEFLGKSSSEAPGRD
SDQTDLTVKLDFGLSHSMLTDEFRAAWPYEFGLVYSVTLTTNSLETALQVRNEGQQNFEF
KVLMHTYLSIADISDIRVKGLESKTYVDKTLQGTSHTESSPALAITQETDRVYQQLDPAV
PIVVASAKDDQPLFSITREALTDVVVWNPWIEKAKGMADFGPDEAYKNMICVEAGSVSAW
QTLEAGEAWEGGQSIKSRL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatcaaacaagccctccgcaattggtgtgggagcttcccttccccagcccacc
ctctctatcaaggacaacgtcgtcgaagcttcgttgcccaccggccagtcagtggccgtg
cacctgtacggcgctactgtgacctcgtggaagaccggcggccaggagcagctgttcgtc
agtgagacagctcatctggatggctccaagcctatccggggtggcattccggtggtgttt
ccagtcttcggtcctccgccccagaaccacgctacctcatccctaccacaacatggcttc
gctcgcaactccaactgggagttcttgggcaagtcctcttcggaagcgcccggaagggat
agcgaccaaaccgatcttaccgtgaagttggatttcgggctgtcgcactctatgctgacc
gatgagttccgcgccgcttggccatatgagttcggtctggtgtacagtgttacgctcacc
acgaactcgctggagacggcactgcaggttcgcaatgagggccagcagaactttgagttc
aaggtgcttatgcacacatatctgagcattgcggatatctccgacatccgtgttaagggt
ctcgaatccaagacatacgtcgataagaccctccaaggaacttctcacaccgaatcgagc
cccgcattggccatcacccaagaaaccgatcgcgtctaccaacaacttgaccctgccgtt
cccatcgtcgttgcctctgcgaaggatgaccaacctttgttctcgatcactcgggaagct
ctgactgatgttgtggtctggaacccttggatcgagaaggccaagggcatggccgatttc
ggcccagacgaagcttacaagaacatgatctgtgtggaggctggctcagtgtctgcttgg
caaacgcttgaagctggagaggcctgggaaggtggacagagcatcaagtcgcgactatga

DBGET integrated database retrieval system