KEGG   Penicillium chrysogenum: Pc18g03560Help
Entry
Pc18g03560        CDS       T01091                                 

Definition
Pc18g03560
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Pc18g03560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MASAARTASRAFLRSTPATSSFRPAARSTRFAIPANGLRASPRRGYASEAGPEKSGSSFG
IWALGLGALGGGAYFYLNGDSASSPKKPFVPTQADYQKVYDAVAARLADDTDYDDGSYGP
VLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKTARDFLEPIKAQFPWITY
SDLWTLAGACAIQELGGPTIPWRPGREDRDVAACTPDGRLPDAAKDQRHIRDIFSRMGFD
DREMVALIGAHALGRCHTDRSGFDGPWNFSPTVFTNEFFRLLAEENWIQKKWNGPKQFTD
KSTGTLMMLPTDMALMKDKGFKKHVERYAKDSDVFFKEFSDVFVKLLELGVPFKTEDRFV
FKTSE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggctgctagaactgcttcccgggccttccttcgctcaaccccggcgacctcc
tctttccgtcctgctgcacgcagcacccgtttcgccatccccgccaacggtcttcgcgcc
tctcctcgtcgcggatatgcttcggaagctggcccggagaagtctggctcatccttcgga
atctgggctcttggtctcggtgccctcggtggtggagcgtacttctacctgaacggcgac
tccgcctcctcccccaagaagcccttcgtccctacccaggccgactaccagaaggtgtac
gacgctgtcgctgcccgtctggccgacgataccgactatgatgacggcagctatggtccc
gtcctggttcgtctcgcatggcacgcaagtggtacctatgataaggagaccggcaccgga
ggcagcaacggcgccaccatgagattcgccccggagtccgatcacggcgccaacgccggt
ctcaagaccgcccgcgacttcctcgagcccatcaaggctcagttcccctggatcacttac
tccgatctgtggactcttgcgggtgcttgcgctatccaagagctgggcggcccaacgatc
ccctggagacccggccgtgaggacagggatgtcgcagcatgcactcccgatggccgtctt
cctgacgccgccaaggaccagcgtcacatccgcgatatcttctcccgcatgggctttgat
gaccgcgagatggttgcactgatcggcgcccatgccctgggccgctgccacaccgatcgt
tccggcttcgacggcccctggaacttcagccctactgttttcacgaatgagttcttccgc
ctccttgctgaggagaactggatccagaagaagtggaacggcccgaaacagttcaccgac
aagtccactggcactctcatgatgttgcccactgatatggctcttatgaaggataagggc
ttcaagaagcatgtcgagcgctatgccaaggacagcgatgtcttcttcaaggagttctct
gatgtctttgtcaagctccttgagctcggtgtgcccttcaagactgaggaccgcttcgtc
ttcaagacttctgagtaa

DBGET integrated database retrieval system