KEGG   Penicillium chrysogenum: Pc18g03850Help
Entry
Pc18g03850        CDS       T01091                                 

Definition
Pc18g03850
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 641 aa AA seqDB search
MALEPISDRLLGSKNKKVAYFYDSDVGNYAYVSGHPMKPHRIRMTHSLVMNYGLYKKMEI
YRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDHFSKEQSRYNVGDDCPVFDGLFEFCGIS
AGGSMEGAARLNRNKCDVAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRVLYV
DIDVHHGDGVEEAFYTTDRVMTCSFHKYGEYFPGTGELRDIGVGQGKNYAVNFPLRDGIT
DETYKSIFEPVIKSVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVKSFDL
PTLVLGGGGYTMRNVARTWAYETGILVGEPLGSELPYNDYYEYFAPDYQLDVRPSNMDNA
NTKEYLDKIRNQVVENLKRTAFAPSVQMTDVPRNPILDGMDDEADDVMDDLDEDENKDKR
FTQRRFDQRTEKAGELSDSEDEDENAANGVRRQPGGMRRRNQVNYRNLEPDSGLDSGMAT
PQDGSSAADGEMDFALDAKMTDAPRTEPEAPFAGPQASHADQTPITDADNMAMESEEQEA
PTASQHQSPHPHEEDTTMEDAAAVAEPTTSEQAPAKAPSTEEKSLVEGSAASPVRAQSPP
KEAADSTLEKSAEASAPTVDTEATATKEENLEPMAEPKKEE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctctggaacctatctctgataggctccttgggtctaagaataagaaagtcgcttac
ttctacgactccgatgtgggaaactatgcctatgtctcgggccaccccatgaagcctcat
cgcattcgcatgacgcacagcttggtgatgaactatggcctctacaagaaaatggagatc
taccgtgcgaaacctgcctccaagtacgagatgacccagttccacaccgatgaatatatc
gacttcttgtccaaggtcacacccgacaatatggaccatttctcgaaggaacagagccga
tacaatgttggagacgattgccccgtcttcgacggtcttttcgagttctgcgggatcagc
gctggaggcagtatggaaggcgccgcacgactgaaccgcaacaaatgtgatgttgccgtc
aactgggctggtggtctccaccacgccaagaagagcgaagcaagtggcttctgctatgtc
aatgatatcgtcctcggaatcctggagcttctgcgcttcaaacaacgagtcctttacgtc
gatattgatgtccaccacggcgatggtgtcgaagaggccttctacacgactgatcgcgtc
atgacctgttctttccacaagtacggcgagtacttccctggtaccggtgagcttcgcgac
atcggtgttgggcagggcaaaaactacgcggttaacttccctctccgggatggcatcact
gatgagacatacaagagcatttttgagcccgttattaagagcgtgatggagtggtaccgc
cccgaggccgtagtccttcagtgcggtggtgacagtctatctggtgatcgcttgggctgc
ttcaacctgagtatgcgaggacacgccaactgtgttaacttcgtcaagagctttgatctg
ccaactttggttcttggcggtggtggttacaccatgcgcaacgttgcacggacatgggct
tatgagaccggtatccttgtcggagagcccctggggtccgagctgccatacaatgactac
tatgagtacttcgctcctgattatcagcttgatgtccgcccctccaacatggacaatgcc
aataccaaagaatacctggacaagattcgcaaccaggttgtcgaaaacctcaagcgcacg
gcatttgctccttcagttcaaatgacggatgtcccacggaaccccatcttggacggcatg
gacgacgaggctgatgacgttatggatgaccttgatgaggatgagaacaaagacaagcgg
ttcacacaacgacgattcgaccaacgcaccgaaaaggctggcgagcttagtgatagcgag
gacgaagacgaaaacgccgccaacggtgttcgtcgccaaccaggcggcatgcgtcgtcgc
aaccaagtcaactaccgaaacctcgagccggactctgggctggatagtggcatggcaacc
ccccaggatggctcatctgcggctgacggagaaatggacttcgcccttgatgctaagatg
actgatgccccacgcactgaacccgaggcgccttttgctggcccgcaagcttcgcacgcc
gatcaaacccccattactgatgctgataacatggctatggaaagcgaggaacaggaagcc
cctactgcctctcaacatcagtctcctcaccctcatgaggaagatactaccatggaggac
gctgctgctgtcgctgaacccactacctcggaacaagctccagctaaagcgccaagtact
gaggagaaatctctggtcgagggctccgccgcctcccctgtgcgagcccaatcccctccg
aaagaggctgctgattctaccctcgagaagagtgccgaagcctctgctcctactgtggac
acggaggcaacggcgaccaaggaagagaatttggagcccatggcagaacccaagaaagag
gagtaa

DBGET integrated database retrieval system