KEGG   Penicillium chrysogenum: Pc18g05510Help
Entry
Pc18g05510        CDS       T01091                                 

Definition
Pc18g05510
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Pc18g05510
Transcription machinery [BR:pcs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Pc18g05510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MDKVESQASDELNLAAKRTACEEQNIAPNAKRAKHIHDGLTQADGKAPAITRRVPFPEKP
AVVEERNGEIEFRVVNNDGSRESTIILTGLKCLFQRQLPEMPKEYIARLVYDRAHLSIAI
VKMPLEVIGGISFREFRDRKFAEIVFCAISSDQQVKGYGAHLMAHLKDYIRATSPVMHFL
TYADNHAIGYFQKQGFTKEITLDNSIWRGCIKDYEGGTLMQCSMLARIRYLEVGRMLLKQ
KASVLAKIRTLSKSHVIHLPPQQWANASDGVVVPIDPLSIPAIRETGWSPGMDELAREAS
HESRFRGPHFNEFRRFLNEIQNHKLAWPFLNPVNKDEVPGYYDIIVSPMDLSTMEERLES
YTTPKDLVRDLKLILSNCRQYNDATTVYAKCAVKLEKYMWKLIKEIPEWSYLLEE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagtagagtcgcaagccagcgacgagctaaatctggccgcgaagcgcacggct
tgtgaagagcagaatattgcgcctaatgccaaaagagccaaacacattcatgatgggctg
acacaggcggatggcaaagctccggctataacccggagggttcctttcccagagaagcct
gcagttgtggaagaacgaaatggcgagatcgagtttcgggttgtcaacaacgatggctct
agagagagtacgattatccttacaggtctcaaatgtctatttcaaaggcaacttccggaa
atgcctaaggaatacatcgcacgtctcgtctatgaccgcgctcatttatcgatcgctatc
gttaagatgcctttggaggtcattggcggtatatcattccgggaattccgagaccgcaag
tttgccgaaatcgtcttttgtgctatttcgtctgatcagcaggtgaaaggatacggagcg
catcttatggcccacttaaaggattatattagagctacttccccggtgatgcattttctg
acttacgccgataatcatgccatcgggtattttcaaaagcaaggttttactaaagagatc
actctcgacaactctatctggagggggtgtattaaggattacgaaggagggacacttatg
caatgctctatgcttgcccgaattcgatatctcgaagttggccgaatgcttcttaagcaa
aaggcatccgtcctagccaaaatacgcaccttgagcaaaagccatgtcattcatctaccg
cctcagcaatgggctaacgctagcgacggtgtcgtggttccaatcgatccactctctatc
cctgccatccgggaaactggctggtctccgggtatggacgagttagcgcgagaagcaagc
catgaatctcgtttcagaggacctcattttaacgaatttcgacgttttctgaatgaaatc
caaaaccacaaactagcatggccctttctcaatcccgtcaacaaagatgaagtacccggc
tattacgatatcattgtatcaccaatggatttgtcgaccatggaagaaagattggagagt
tacactactccgaaagatcttgtccgcgatctcaagttgatcttaagtaactgtcgccag
tataatgatgccacaacggtgtacgctaagtgtgcagtcaagctggagaagtacatgtgg
aagctcatcaaggagattccggagtggtcatacttgcttgaagaatga

DBGET integrated database retrieval system