KEGG   Penicillium chrysogenum: Pc18g06080Help
Entry
Pc18g06080        CDS       T01091                                 

Definition
Pc18g06080
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc18g06080
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pc18g06080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 332 aa AA seqDB search
MRFDHIALLAAVAGSAAAAPAKNAKRASPFQWFGTSESGAEFGEDNLPGVYGKDYYFPDA
STIQTLAGKGMNIFRVAFRMERLVPNSMTGGFDDAYLSNLTATVRAITDAGSHAVLDPHN
YGRYNGEIMSSTSDFQTFWKNVAGEFASNELVIFDTNNEYHDMDQDLVLKLNQAAIDGIR
DAGATSQYIFVEGNSWTGAWTWVDVNDNMKALTDPQDKIVYEMHQYLDSDGSGKSETCVS
TTIGKERVTAATQWLKDNNKVGVIGEFAGGVNDNCKAAITGMLDYMGDNSDVWRGALWWA
AGPWWADYIFSIEPPTGVAYTGMLSTLEPYLQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagattcgatcacattgccctcctcgccgctgtggccggatccgcagcagcggctcct
gccaagaatgcaaagagagcttcgcccttccaatggttcggaacaagcgagtccggggct
gaatttggcgaagacaaccttcctggtgtctacggaaaggattattacttccccgacgct
agcaccatccaaaccttggctggaaaaggaatgaacatcttccgggtggcattcagaatg
gagcggctggtaccgaactccatgacaggcgggtttgacgacgcctatctaagcaatttg
accgcgacggtcagagccatcactgatgcgggatcccacgccgtgcttgatccgcacaac
tatggaagatacaacggcgagatcatgtcgagcacctccgacttccagacattctggaag
aacgtcgcaggcgaattcgcctcgaatgagctagtcattttcgacacaaacaacgagtac
cacgacatggaccaagacctcgtcctcaagctcaaccaggcagccattgacggcatccgc
gacgcgggcgccacaagccaatatatcttcgtcgagggcaactcttggaccggcgcatgg
acctgggtcgacgtgaacgataacatgaaggccctaaccgacccccaagacaagatcgtc
tacgagatgcaccagtacctcgactcggatggatcaggcaagagcgagacatgtgtgtcg
acgacgatcggaaaagagcgcgtgacggcggcgacacagtggctgaaggataacaacaag
gttggggttattggcgagtttgccggtggtgtgaatgacaactgcaaggcggcgattaca
ggcatgcttgattatatgggtgacaactcggacgtctggcgtggagcattgtggtgggct
gctggtccttggtgggcggactacatcttcagtattgagcctcccactggcgtggcctac
acgggtatgttgtcgacacttgagccatatttgcagtaa

DBGET integrated database retrieval system