KEGG   Penicillium chrysogenum: Pc20g01400Help
Entry
Pc20g01400        CDS       T01091                                 

Definition
Pc20g01400 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pcs01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pcs01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MSSKPDATRPRAADTKKVHIADTQMTRQNWYKHVNWLNVTFIIGVPISGCIQAFFVPLQL
KTAIWAVIYYFFTGLGITAGYHRLWAHCSYSATLPMRIWLALVGGGAVEGSIRWWARDHR
AHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITDLNEDPVVVWQHRNYIKV
VITMGLIVPMLVAGLGWGDWYGGFVYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNSP
RDHIITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWTIWTCKQLGLAYDLKQFRSN
EIEKGRVQQLQKKIDQKRAKLDWGTPLDQLPVMEWDDYVEQAKNGRGLISIAGVVHDVTD
FIKDHPGGKAMIKSGLGKDATAMFNGGVYYHSNGAHNLLSTMRVGVIRGGGEVEIWKRAQ
KENSEYVRDETGQRIIRAGQQVTKMPEPIPTADAA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaagccggatgctacacgccctcgggcggctgacaccaagaaggtgcacatt
gccgatacccagatgactcgccagaactggtacaagcatgtcaactggctcaacgtcacc
ttcatcatcggcgttcccatctccggatgtatccaggctttcttcgtgcctctgcagctg
aagaccgccatttgggcagtcatctactacttcttcactggactgggaatcacagctgga
taccatcgtctctgggctcactgctcctattccgccactttgcctatgcgtatctggctc
gctctggtcggcggcggtgctgtcgagggctccatccgctggtgggctcgtgatcaccgt
gcgcaccaccgttacaccgacaccgacaaggacccttactccgtgcgtaagggtttgctg
tactcgcacctaggatggatggtcatgaaacagaaccccaagcggattggtcgtactgat
attaccgatctgaacgaagaccccgttgttgtctggcagcaccgcaactacatcaaggtc
gtgatcactatgggtcttatcgtccctatgctcgtcgctggtctcggctggggtgactgg
tacggcggattcgtgtacgccggtattctgcgtatcttcttcgtgcaacaggctaccttc
tgcgttaactcgctggcccactggctcggtgaccagcccttcgatgaccgcaactctccc
cgtgaccacatcatcaccgccctagtcactctcggcgagggctaccacaacttccaccac
gagttcccctcggactaccgcaatgccattgagtggcaccagtacgaccccaccaagtgg
accatctggacctgcaagcagctcggcctggcctacgacttgaagcagttccgctccaac
gagatcgagaagggccgcgtccagcagctgcagaagaagatcgaccagaagcgcgccaag
ctcgactggggtactcccctggaccagcttcccgtcatggagtgggatgactatgttgag
caggccaagaacggccgtggcctgatctccattgccggtgttgttcacgacgtgaccgat
ttcatcaaggaccaccccggtggcaaggccatgatcaagtccggccttggcaaggacgcc
acggccatgttcaacggtggtgtttactaccactccaacggtgcccacaacttgctttcc
accatgcgtgtcggagtcatccgcggcggtggtgaggttgagatctggaagcgcgctcag
aaggagaactccgagtatgtgcgtgatgagacaggccagcggattatccgggccggccag
caggtcactaagatgcctgagccgatcccaactgcagatgcagcttaa

DBGET integrated database retrieval system