KEGG   Penicillium rubens: Pc20g01630Help
Entry
Pc20g01630        CDS       T01091                                 

Definition
(RefSeq) Pc20g01630
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pcs  Penicillium rubens
Pathway
pcs00010  Glycolysis / Gluconeogenesis
pcs00020  Citrate cycle (TCA cycle)
pcs00620  Pyruvate metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
Module
pcs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc20g01630
   00020 Citrate cycle (TCA cycle)
    Pc20g01630
   00620 Pyruvate metabolism
    Pc20g01630
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pc20g01630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh DUF5353 Biotin_lipoyl E3_binding DUF3614
Motif
Other DBs
NCBI-GeneID: 8312300
NCBI-ProteinID: XP_002562722
UniProt: B6HDH0
AA seq 661 aa AA seqDB search
MVASAIRMRTPSAMFMSRGAAAMRRPQVSSKLQEVIQTQVPALSALSRFYASKSFPPHTL
ISMPALSPTMTAGNIGVWQKKAGDALQPGDVLVEIETDKAQMDFEFQDEGVLAKVLKESG
EKDVSVGSPIAVLVEEGSDVSAFESFTLADAGGDKPAPTEQKEEPKSAEPSTPAPAEEAP
AAQEPETSGEKLQPSLDREPSISPAAKVLALEKGVSIKGLKGTGRGGVITKEDVEKAKPA
TTAVSGEATFEEIPVSSMRKTIANRLKQSMTENPHYFVSTTLSVTKLLKLRQALNASADG
QYKLSVNDFLVKACAVALLKVPQVNSSWREENGQAVIRQHKTADISVAVSTPTGLITPVV
KNVQGLGLSSISKQVKDLGKRARENKLKPEEYQGGTFTISNMGMNAAVERFTAVINPPQA
GILAVGTTRKVAIPVETEEGTVTEWDDQIIVTGSFDHKVVDGAVGGEWIKELKKVVENPL
ELLLISPDYVLIPSRTNMSYADAAAKGPKQSPEDVRIQTRIFTLRRAPPVGGIYRDESES
TASLIDVDGPHVQTVESDFLKHDVQTTTQAERIDREAEEKEKREDEEKKKARSQKAKSSG
ICGNTSNPVFIANAAIATVVGAGLGFGVYKQHARGNLSWELVGLSAGAVGIFGAVDYFVS
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgtcagctattcggatgcgcaccccgagtgccatgttcatgtctagaggtgcc
gccgctatgcgccggccccaggtctcctccaagctccaggaggtgattcagacccaagtg
cctgcgctctctgccctttcccgcttctatgcctccaagtccttccctccccacacactt
attagcatgccggcactttcgccgaccatgaccgccggaaacatcggcgtgtggcagaag
aaggccggagatgccctccagcccggtgatgtcctggtggagatcgaaaccgacaaggct
cagatggatttcgagttccaggatgagggtgtcctggccaaggttctgaaggagagcggc
gagaaggatgtctctgttggctcgcccattgccgtccttgttgaggagggttccgatgta
tccgccttcgagtccttcaccctggctgatgctggtggtgacaagcctgcccccactgag
cagaaggaggagcctaagagcgctgagccttcgaccccggccccagccgaagaggcaccc
gccgcgcaggagcccgagacgtcaggcgagaagctccagcccagtcttgaccgtgagccc
tctatcagccccgccgctaaggtcttggcccttgagaagggtgtgtccatcaaggggctt
aagggtaccggccgtggtggtgtcatcacgaaggaggatgttgagaaggccaagcccgcc
accaccgctgtttccggcgaggctaccttcgaggaaatccccgtcagctcgatgcgcaag
accatcgccaaccgcctgaagcagtccatgaccgagaaccctcactacttcgtctccacc
actctctcggttaccaagctcctgaagctccgccaggccctcaacgcttccgctgacggt
cagtacaagctttccgtcaacgacttcttggtcaaggcatgcgctgttgcccttctgaag
gtcccccaggttaactccagctggcgcgaggagaacggccaggccgtgatccgtcagcac
aagaccgctgacatcagcgtcgctgtgtctacccccactggtttgatcacccccgttgtc
aagaacgttcagggtctcggactctccagcatctccaagcaggtcaaggaccttggcaag
cgtgcgcgcgagaacaagcttaagcccgaggagtaccagggcggcactttcaccatctcc
aacatgggtatgaacgccgctgtcgagcgcttcaccgctgtcatcaaccccccgcaggcc
ggtatcctggctgttggcaccacccgtaaggttgctatccccgtcgagaccgaagagggc
accgttaccgagtgggacgaccagatcatcgtcactggtagcttcgaccacaaggtggtt
gatggcgccgttggtggtgaatggattaaggagctgaagaaggtcgtcgagaaccctctg
gagcttctgctgatttccccagattacgttctaataccatcacgcacaaacatgtcttac
gccgacgcagctgcaaagggccctaagcagtcccccgaggatgtacgtattcaaactcgt
atattcacattacgccgcgctccccctgtgggcggaatctaccgcgatgaatccgagagc
acagcctcgttgatcgacgtcgatggccctcatgttcagactgtggaatccgacttcctg
aagcacgatgtccaaaccaccacccaggcggagcggatagaccgcgaagccgaggagaag
gagaagcgtgaggacgaggaaaagaagaaggcaaggagccaaaaggcgaagagcagtggc
atctgtggaaacaccagcaaccctgtctttatcgccaatgccgctatcgcaaccgtcgtc
ggcgcaggcctcggctttggtgtctacaagcaacacgcgcggggcaacctctcctgggag
ctggtcggactctctgccggtgctgtcggaatctttggtgctgtggactactttgtcagc
aagtaa

DBGET integrated database retrieval system