KEGG   Penicillium chrysogenum: Pc20g01940Help
Entry
Pc20g01940        CDS       T01091                                 

Definition
Pc20g01940
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pcs00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MRFISLLSIAGVTGLVLAAPGPSLSKRAGSFVWFGANEAGAEFGSGNIPGELGTDYIWPS
TSTIQTLRDAGMNLFRIPFAMERLVPGTLTSSMDATYLASLKSTVNYVTSSGGYAVIDPH
NFGRYYGNIITSTSDFAAFWTALASEFASNDKVIFDTNNEFHSQDQTLVLNLNQAAINAI
RAAGAKSQYIFVEGNSWSGAWTWTTVNDNMKALTDPQDLIIYEMHQYLDSDGSGTSETCV
SSTIGRERVVAATQWLKDNGKRAFLGEFAGGANPVCQSAVTGMLDYLQANSDVWVGASWW
SAGPWWGNYMYSLELPSGVGYTYYMSLLRNYFPGSTGSGGTTTAAPTSTPTVATATKTTT
TGSSTTGAAHYAQCGGKSWTGATTCASPYACQKQSDYYSQCL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttatctctttgctttcgatagccggcgttacaggcctagtgctggcagcaccg
ggtccatccctatctaaaagggctggttccttcgtctggttcggcgccaacgaagctggc
gcagagtttgggagtgggaacattccaggggaactaggaacagattatatctggccgtcg
acctcaaccatccaaaccctgcgtgatgcagggatgaatttattccgcattcccttcgcg
atggagcggttggttccaggaactctgacatctagcatggatgcgacttacctggcttca
ttgaaaagtactgtcaactatgtcacgtccagcggtggatatgccgttattgaccctcac
aattttggacgatattatggcaatatcatcacctctactagtgacttcgcagccttttgg
acggcccttgcatcggaattcgcatcgaatgacaaggtcatcttcgatacaaacaatgaa
ttccattcgcaagaccaaaccctggtgttgaacctaaatcaagctgctatcaatgctatc
cgtgctgcaggagcaaaatcgcagtacatcttcgtggagggtaactcatggagtggtgcg
tggacatggacaactgtcaatgacaatatgaaagccttgacagacccacaggacttgatt
atctatgagatgcaccaataccttgactctgacggttccgggacatcggagacatgtgtc
agctcaactatcggacgagaacgagtcgtggctgccacacagtggctcaaggacaatggc
aagagggcatttttaggtgaatttgccgggggtgccaatcctgtctgtcaaagtgcagtg
acaggtatgctcgattacttgcaagcgaatagcgatgtctgggttggtgcgtcctggtgg
tccgctggaccatggtggggaaactacatgtacagtctcgagcttccttccggcgtaggc
tatacctactacatgagtcttctgaggaattatttccccggctcaactggttcgggtggg
acaaccacagcagccccaacttccacaccaactgtcgctactgctaccaagaccaccaca
actgggtcaagcaccaccggcgcggctcactatgcgcagtgtggtggaaagagctggacc
ggggcaaccacctgtgctagcccatacgcctgccagaagcagagtgactactattcgcag
tgcctgtag

DBGET integrated database retrieval system