KEGG   Penicillium chrysogenum: Pc20g03710Help
Entry
Pc20g03710        CDS       T01091                                 

Definition
Pc20g03710
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Pc20g03710
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Pc20g03710
Peptidases [BR:pcs01002]
 Metallo Peptidases
  Family M67
   Pc20g03710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 546 aa AA seqDB search
MPSNATGGATGATAPQSVENITRIAQNYEYNSSVPLRYWLRTATTLLREARIYEREGHDE
QAYLILFRHAQLILVHLSKHPDTKKNEEDRKALVAAEKEVEKNLSKLEILRPRINKRYER
YTQLMRERESRKQPSRTKIVAEPREQVADPALAGVAEPLEAGENRDLAVQLAQSELNRRA
TVRDSKSLSGPSAEELETRRAAGVWGDWDHSIKSESRAGDRDLGQRVQDISSKPDHTDGP
YGQRAKEPVVPSSATSTYNYPTVPRQRPLEPAVSPGNIAILDKNVERQAPPILPPKEHLE
PSRASIVNDSATDLAPARPAKVLPGPALPEKIRPSEQATATRSDLDPSSYTFKPSAYLEN
GTPLRSVFLPANLRSRFLSLVAPNTRANLETCGILCGTLVSNALFISKLVIPEQTSTSDT
CETVNESALFDYCDSEDLMTLGWIHTHPSQTCFMSSRDLHTHCGYQVMLPESIAIVCAPS
KSPDWGVFRLTDPPGLKSVLNCHQTGLFHPHAEENIYTGALRPGHVFEVSGLEFETVDLR
PGSLKN
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgccttccaatgcgacgggcggtgccactggagctactgcccctcagagcgttgagaat
atcacgcggatagcacagaactacgagtacaactcctctgttccattgcggtattggctc
aggaccgccacaacgcttttacgcgaggcccgtatatatgaacgcgaaggacacgatgag
caagcctatctcattctatttcgacacgctcagttgatcctggtccatctgtctaagcac
cccgataccaaaaagaacgaggaagatcgcaaggctttggtggcagccgagaaagaggtt
gagaaaaaccttagcaagctggagattctgaggccgcgtatcaataagcgatatgagcgt
tacactcagttgatgcgggagcgcgaatctcgcaagcagccctcccgaaccaagatcgtc
gccgaaccacgagaacaagtcgccgatcccgctcttgccggcgtggcagagcctttggaa
gctggggagaatcgagatctcgccgtgcagttagctcaatcagagctcaaccgccgagcc
acagtccgagactcaaagagtctttctgggccatctgccgaagagctggaaactcgtcgc
gcagctggtgtatggggtgactgggaccattctatcaaatcggaatcccgcgcgggtgat
cgcgacctcggtcagcgcgttcaggatattagctccaagcccgatcatacagatggacct
tatggtcaacgtgcgaaagagcccgtggtcccttcgtccgctacttctacgtacaattat
ccaactgtgccacgtcagaggccgttggagcccgctgtgtctccaggcaatattgccatc
ctcgataagaacgtcgaacgccaggcacctccgatattgcctccgaaggagcaccttgag
cctagccgggcatctatcgtcaatgattctgcaacagatttagcgccagcgcggccagct
aaagtattgccaggtccggcgctgcctgagaagatccgaccttccgaacaagcaaccgct
acgcgctcagatctcgatccctcgagttacaccttcaaaccctccgcctatctcgaaaat
ggcacccccctgcgctcggtatttttaccagcgaacctacgatcccgcttcttatctctg
gttgctcctaacacccgcgccaaccttgagacatgcggtattctgtgtggtacccttgtc
tccaacgcgctcttcatatccaagctggtcatccccgagcagacatcgacatcagacacc
tgcgaaacggttaacgaatccgctctttttgactactgtgactcggaggatttgatgaca
ctcggctggatccacacacatccgtcacagacttgtttcatgagctcccgtgatctacac
acgcactgcggttaccaagtgatgctgccagagagtattgccatcgtgtgcgctccgagt
aaaagtcccgactggggtgtgttccgactgactgatcctccgggtctaaagtcggttttg
aactgccaccagacgggtctgttccacccacatgccgaggagaatatctacacgggggcc
ttgcggccgggacatgtcttcgaagtcagtgggttggaatttgagacggtggaccttcgt
ccgggttcgttgaagaactaa

DBGET integrated database retrieval system