KEGG   Penicillium chrysogenum: Pc20g04310Help
Entry
Pc20g04310        CDS       T01091                                 

Definition
Pc20g04310
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Pc20g04310
  Amino acid metabolism
   00380 Tryptophan metabolism
    Pc20g04310
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Pc20g04310
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Pc20g04310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1119 aa AA seqDB search
MSSTDQVPIPGPKGVPFLGNVYDIEPELPLQSFERMADSYGPIYRLTTFGRARVFVSSHE
LVDEVCDEERFSKMVSAGLAEIRNGVHDGLFTANYPGEENWAIAHRILVPAFGPLMIRGM
FDEMYDIATQLVMKWARIGPAAPIQVTDDFTRLTLDTIALCAMGTRFNSFYHDEMHPFVE
AMVGLLSVSGHRALKPALLNNLPTSENNKYWSDIEYLRNLSKELVDSRKENPVDKKDLLN
ALILGRDPQTGRGMTDDSIVDNMITFLIAGHETTSGMLSFLFYHLLKNPSAYRKAQDEVD
RVIGKRKITVDDMSKLPYITAVMRETLRLNPTAPMIALHPHPTKNKEDPVTLGGGKYVLN
GDETIALLLTKMHRDPKVYGPDADEFKPERMLDENFEKLPKNAWKPFGNGMRGCIGRPFA
WQEALLVVAILLQNFNFQMENPSYDLRLKQTLTIKPKDFHMKATLRDGLDPTQLSTTLSG
SGAGPTETGAASRDRKPKVAPAGGKLKPMHVFYGSNTGTCEAFARRLADDAAAYGYAAQT
NSLDSAMQNIPKNDPVVFISASYEGQPPDNAAHFFQWLSELKGSELEGVNYAVFGCGHHD
WSSTFYRVPKAIDELAKTNGANKLCDIGLADAANSDMFTDFDGWGETLFWPGVMAKFGGT
SPEPAAKPKSSLQVEVSSGMRASTLGLQLEEGFVIENQLLTPPGAPAKRVVKFKLPSDMT
YQCGDYLAVLPVNPSPVVRRAIRRFDLPWDAVLKVKKPSGSTSSPSIPIDTPISAFELLS
TYIELSQPASKRDLNVLADAAISDAELQAELRYLASSPSRFTEEIVKKRVSPLDLLIRYP
SIKLLIGDFLAMLPPMRVRQYSISSSPLVDPSECSITFTVLSAPALANATPEGSESIEQY
LGVASNYLSELQAGERAHITVRPSHSGFKPPMDLETPMIMACAGSGLAPFRGFVMDRAEK
IRGRRSSPDSDELHESETFKPAKAVLYIGCRTKGQDDIHAAELAEWAALGAVDVRWAYSR
PADGSKGQHVQDAMLDDREELVKLFDEGANIYVCGSTGVGAGIRDACKQMYLERRRAVHA
ELREKGETPPGADLEEDQAAEQFFDNLRTKERYATDVFT
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaccgaccaggtcccaatcccgggccccaagggtgtcccattcttaggaaac
gtctacgacatcgagcccgagttgcccttgcaaagctttgagcggatggccgatagctat
ggcccaatctatcgcttgaccacctttggcagagcacgagtattcgttagctcccacgag
ctagtggacgaagtctgtgacgaggaacgcttcagcaaaatggtctccgctggtctggct
gagattcgcaatggtgttcacgacggtctttttaccgcgaactatcccggtgaagagaac
tgggctatcgcgcatcgcattcttgttcctgcattcggtccgctgatgattcgcggcatg
tttgatgaaatgtatgatattgccactcaactggttatgaaatgggctcggattggccct
gctgccccaatccaggttacagatgacttcacccgcttgacgctagataccattgctctt
tgcgctatgggcacccgcttcaactcgttctaccatgatgaaatgcacccattcgtcgag
gcaatggttggcttgctatctgtgtctggacatcgggctcttaagcctgctttgctcaac
aacctccccacttcagagaacaacaagtactggagtgacattgagtatctgcggaatcta
tccaaggaattagttgattcacggaaagagaaccccgttgacaagaaggatcttctcaat
gcgcttatcctgggtcgggacccgcagactggccggggtatgacagatgactcgattgta
gacaacatgatcacattcctcatcgctgggcacgagaccacctccggcatgttgtcattc
ctattctaccatcttctcaaaaaccccagcgcatacagaaaggctcaagacgaagtcgac
cgtgtgattggtaaacgcaagatcaccgttgatgacatgtccaagctgccatacatcacc
gctgtgatgcgcgagacgctgcgtctgaaccccacagccccgatgattgccctgcacccc
caccccactaagaacaaggaggatcctgttacacttggaggtggcaagtacgtgcttaac
ggggacgagacaattgcgctcctacttaccaaaatgcaccgagacccgaaggtctacggc
cctgacgccgacgagttcaagccagagcgcatgctcgatgaaaacttcgagaagctgccc
aagaatgcatggaagccatttggaaacggcatgcgaggctgtattggacggccgttcgca
tggcaagaggctctccttgtagttgcgattttgctgcagaactttaacttccagatggag
aaccccagctacgatctccgccttaagcagacacttaccatcaagcccaaggatttccac
atgaaagcgactctgagggatggactcgaccctactcaactaagcactaccctcagcggc
tctggtgccgggcccacagagactggcgccgccagccgggatcgcaagcccaaggttgca
cccgcgggtggcaagctgaagcccatgcacgtgttctacggcagcaacacaggaacctgt
gaggccttcgcccgcaggctggccgacgatgccgctgcatacggttatgctgcgcagaca
aactctttagattcagccatgcaaaatatccccaagaacgaccctgttgtctttatctca
gcgtcttacgaaggacagcctccggacaatgcggcccacttcttccaatggctcagtgag
ttgaagggcagcgagttagaaggtgtcaactacgcagtcttcggctgtggccaccatgat
tggtcgtcaaccttctaccgtgtccccaaggccatcgacgaactagccaagaccaatggg
gccaacaagctctgcgacattggtcttgctgacgcagcaaactcagacatgttcaccgat
ttcgatggctggggcgagaccttattctggccgggcgtgatggctaaattcggtggaact
agcccggaacccgccgccaagccgaagtcttcattgcaggtcgaagtgagctcgggtatg
cgcgcatccaccctgggtctccagctcgaagaaggtttcgtcattgagaaccagctcctt
acgccacccggggccccagccaaacgagtagtcaagttcaagctaccgtcagacatgacc
taccagtgcggtgattacctcgcagtgctacccgtgaacccaagcccagtcgtccgtcgc
gcaatccgccgcttcgacctcccctgggacgccgtgctcaaagtcaagaaaccctcaggc
tcaacatcctccccctcgatccccatcgacacgccgatctcagccttcgagctcctatcc
acctacatcgagctatcccaacccgcatcgaagcgcgatctcaatgtcctagccgacgcc
gccatctcagacgcggaactgcaagccgaactacgctatctcgcatccagccccagccgc
ttcacggaagaaatcgtcaagaagcgcgtcagcccgctggatctgctaatccgctatcca
tcaatcaagctactgatcggcgacttcctcgcaatgctcccaccaatgcgcgtgcgacaa
tactccatctcctcgtcaccactcgtcgacccatccgagtgctcgataaccttcaccgtc
ctcagcgctccggccctcgccaacgccaccccagaaggcagcgaaagcatcgaacaatac
ctcggcgttgcatccaactacctctccgagctccaagccggtgaacgcgcacacatcacc
gtccgtccctcgcactcaggcttcaagccgcccatggatctcgaaacaccgatgatcatg
gcctgcgcgggctctggactcgccccgttccgtggattcgtgatggaccgcgcggagaag
atccgcggccgccgcagctcgcctgactcagacgaactccatgaaagcgagactttcaag
cctgcaaaggcggtgttgtatattggctgccgcacgaagggccaggatgatatccacgct
gctgaacttgcggagtgggctgctctcggcgctgtcgatgtccgctgggcgtatagccgc
cctgctgatggaagcaagggacagcatgttcaggatgccatgcttgatgaccgcgaagag
ctggtgaagctgtttgatgaaggagcgaatatttatgtttgcggtagtactggtgttggt
gctggtattcgcgacgcttgcaaacagatgtatctcgagaggcgtcgtgcggtgcacgct
gagcttagggagaagggggagactccgcctggtgctgatcttgaggaggatcaggctgct
gagcagttctttgataatttgcggacgaaggagcgttatgctaccgatgtgtttacttag

DBGET integrated database retrieval system