KEGG   Penicillium chrysogenum: Pc20g04620Help
Entry
Pc20g04620        CDS       T01091                                 

Definition
Pc20g04620
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pcs  Penicillium chrysogenum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pc20g04620
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pc20g04620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 301 aa AA seqDB search
MNSSPLLYSGATPSAGERGQDSFERQNIDSPVNASFACRVPIELRSIEEGPAVALASGLA
SQATGAGHTTVTLSSQTTFHEPTREPWDGKESFSSGPYPLGAEIIQKLESPQGENRGVQK
LARAVCTILECIGEEPTREGLRATPERYANAMLYFTKGYAESVHDLVNGAVFHEGHDELV
ILRDIDVFSLCEHHLVPFTGKVHIGYIPDNRILGLSKLAHLVEMFARRLQVQERLTKQVA
LAISEALNPRGVAVVMECSHLCMVMRGVQKVGSTTTTSCMLGCMRSNAIAREEFLALLSR
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtagccccctcttatattcgggcgcgacccctagcgctggtgaacggggtcag
gattcttttgaacgccagaacatcgattcacccgttaacgcttcgttcgcctgtcgtgtt
cccattgagttacgctcaatagaggagggccctgccgtcgcccttgcttctgggctcgct
tcccaagctaccggagccggtcataccacggtgaccttgagttcccaaactacgttccat
gagccgactcgcgagccttgggatggcaaggaaagcttttcatctggcccatacccccta
ggcgccgagataatacaaaagctggaatcgccacagggagaaaatagaggtgttcagaag
cttgcccgggcagtgtgtacgatacttgaatgcatcggcgaagaaccaacaagagaaggt
ctacgtgcgacaccagagcgatatgccaatgctatgctatattttactaagggctacgct
gagagtgtccatgacttggttaatggagctgttttccacgagggccacgatgaattagtc
atattgagggatattgatgtcttctccctctgcgaacaccacctggttccatttactggg
aaggtgcatatcggttatattcctgataaccgcattcttggtctttccaaattggcacac
ttggttgaaatgtttgcccgcagactacaggttcaagagcgcctgacaaaacaggttgct
ctggccatttctgaggcgctcaatcctcggggcgtcgccgttgtcatggaatgctcccac
ctttgcatggttatgcgtggcgtccagaaggtcggcagcactacaactacaagctgcatg
ctgggatgcatgcggtcgaacgcgatagccagagaagaattcttggcgctcctgagccga
agatag

DBGET integrated database retrieval system