KEGG   Penicillium chrysogenum: Pc20g06510Help
Entry
Pc20g06510        CDS       T01091                                 

Definition
Pc20g06510
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    Pc20g06510
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Pc20g06510
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Pc20g06510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 819 aa AA seqDB search
MASPNSLPAYNELYRQPARPMSRSAVSRSGSRRVSPSTQALPKHYSGDSSDEEVPEPKFS
ASVKALLHGDGLGSSPHLQKAHISHEPRIATSREQSHSPRNSSPHDSSNGSPAPRVVRIG
AISSGSRFSRESSPLSNSQSAEPEHHSHPNDFITPAPRQRSVRINVSRSNTRSPASVSPS
GKRSSERNSGEEYSSAERSDSDRKSQYDDDPALRYGLSSALRGRGGEENAPHSSLRVKRV
GRLAGTFLNGPARRGVLRRQSEESNEENHQYLSADGVREDVEGEEENAEYGHRNPAKPSS
PKVSWADPSPPLSRQSNRREYPLRPAEVEGPFSRSSSPKSYGSKSTPASSEMSDKSSKEQ
PQPVFKVPSIPALPSVRDQENEPPPTFRRARPQGLNVLDKPDKYNVVYDTEKKDVVETPA
TNSARKILATRSSNTPHRAAPPPPKMSVLETATSTGGASTSQSRKKKSQVSINGKHFTRL
DCIGRGGSSRVYRVMAENYKIFALKRVNIEDVDPVTLTGYKGEIDLLKKLENVDRVVRLF
DWELNNDKHALSVLMEIGESDLEKILTFRLNAEDAVFDINFTRFYWKEMLECVQAVHEHN
IVHSDLKPANFLMVQGRLKLIDFGIANAIQDNTVNVHREQQVGTPNYMSPEALVDSNVSL
GLPSSVGKVMKLGKPSDVWSLGCILYKMVYGQPPFAKIAKYYERIMAIPNPRVQIEFPAF
GVGGVPVPPGLVRTLKRCLQRDQTLRPTIEEMLGPRDPFLHPDAQLEGAVPVTQDMLGRI
LANVVNHCKARGVPREEELAAWPAGFFAKIKAALEEENP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccgaattccctcccagcatacaacgagctgtaccgacagccagcccgaccg
atgtcccgatccgcggtttcacgttcgggttccagacgggtatctccatcaacacaggct
ctgcccaaacattactccggcgacagctccgacgaagaggtacccgaacctaaattcagc
gcttctgtaaaagcattgttgcatggagatggattaggttcttcgcctcatttgcaaaag
gcacacatatcgcacgaacctcgaattgcaacatcaagagagcaaagccactcacctcgg
aattcgtccccacacgactcgtctaacggtagcccggctccaagagtcgtccgtataggg
gccatctcgtcgggttctcgattctcacgcgaaagctccccactatcgaatagtcagagc
gcagaaccagaacaccacagccaccccaatgattttatcacccccgccccacgccaacgg
agtgttcgcatcaatgtttcgcgcagcaatacgcgatccccggcatccgtctcgccttca
ggaaagcgctcgtcggaacgcaattcgggcgaagagtatagcagtgcggagcgctcggat
agtgatcggaaatcgcaatatgacgatgatccagcgttacgatatggcctttcttccgca
ttgcggggtcgcggcggcgaagaaaacgctccacacagttcgctgcgtgtgaagcgggtt
ggtcgactggctgggacgttcttaaacggtccagcccggaggggtgtgctacgacgccag
agcgaagagagtaacgaggagaaccaccaatatctttcggctgacggcgtccgggaggac
gtcgaaggagaggaggagaatgccgaatatgggcatcgcaatccagcgaaaccttcgtca
cccaaggtgtcatgggcggacccaagcccgcctctttctcgtcaatccaatcgacgagaa
tatcctctgcgccccgctgaggttgaaggaccgttttctaggtcatcttcgccaaaatca
tacggctcaaagtccactcccgcttcatcagaaatgtccgacaaatcctcgaaggaacaa
ccacaacccgtattcaaagttccttcaataccggctttgccatcggtccgggaccaagag
aatgaaccaccgccaactttccggcgcgcaaggccccaaggcttgaatgtgctggacaaa
cccgataagtataatgttgtttacgataccgagaagaaagatgtcgtggagaccccagca
accaactctgcacggaagatacttgccacacggagcagcaacacccctcatagggccgct
ccccctcccccgaagatgtcagttcttgagactgctacttccacaggaggcgcgtcgaca
tcacaatcacgaaaaaagaaaagccaagtttcgattaacggcaagcatttcactcgactc
gattgcattggtagaggcggcagctcgcgtgtctatcgggtgatggcagagaattacaag
atattcgctctcaagcgggtcaatattgaagatgtcgatccagtgactttgactggatac
aagggtgaaatcgacttattgaaaaaattggagaacgtggaccgtgtggtgcgcttgttt
gactgggagctgaacaatgacaaacatgctcttagtgtgcttatggagattggagagtct
gatcttgaaaagattctcacattccgtttgaacgccgaagatgctgttttcgatatcaac
tttacccgattttattggaaggagatgctcgaatgtgttcaagctgttcacgagcacaac
atcgtccactcggatttaaaacccgccaacttcctcatggtacaaggccggctgaagctc
atcgactttggaatcgcaaatgcgattcaagataatacggtcaacgttcaccgtgaacag
caagtcggcacaccgaattacatgtcccctgaagcattggtcgattccaacgtgtccctt
ggtctgccttccagtgtcgggaaagttatgaaactagggaaacccagcgatgtctggagt
ttaggttgtattctgtacaagatggtctacggacaaccaccattcgccaagatcgccaaa
tattacgaacgcatcatggccatccccaacccccgtgtacaaatcgaattcccggccttc
ggcgtcggtggcgtcccagtgccccctggacttgttcggactctcaagcgctgtctgcag
cgtgaccaaactctccgaccaactattgaggagatgcttggcccgcgcgaccccttcttg
catcccgatgcccagcttgagggtgctgtcccagtcacccaggatatgcttggccgtatt
ctagccaacgtcgtcaaccactgcaaggcccgcggtgtaccccgagaagaggagctggct
gcatggcctgcaggcttctttgcaaaaataaaagcagctctcgaagaagaaaacccgtga

DBGET integrated database retrieval system