KEGG   Penicillium chrysogenum: Pc20g07020Help
Entry
Pc20g07020        CDS       T01091                                 

Gene name
XylP
Definition
endo-1,4-beta-xylanase A precursor XylP-Penicillium chrysogenum
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Pc20g07020 (XylP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 331 aa AA seqDB search
MIPNITQLKTAALVMLFAGQALSGPVESRQASESIDAKFKAHGKKYLGNIADQGTLNGNP
KTPAIIKANFGQLSPENSMKWDATEPSQGQFSFAGSDYFVEFAETNGKLIRGHTLVWHSQ
LPSWVSSITDKTTLTDVMKNHITTVMKQYKGKLYAWDVVNEIFEEDGTLRDSVFSRVLGE
DFVRIAFETAREADPEAKLYINDYNLDSATSAKLQGMVSHVKKWIAAGVPIDGIGSQTHL
GAGAGAAASGSLNALASAGTEEVAVTELDIAGASSTDYVDVVNACLDQPKCVGITVWGVA
DPDSWRADESPLLFDASYNPKEAYNAIAAAL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgattcccaatatcactcaactcaagacagctgctctggtcatgcttttcgctggccaa
gcgctgtccggacccgttgaatcccgacaagcctctgagagcattgatgccaaattcaag
gcccacgggaagaaatacctgggaaacattgctgaccagggcaccttgaacgggaacccc
aagaccccggcaatcatcaaggctaacttcggtcaactctctccggagaacagcatgaag
tgggatgctactgagccaagccaaggacagttctccttcgcaggatccgactatttcgtc
gaatttgcggagacaaacgggaagctgattcgcggccatactctcgtgtggcactcccag
ctcccatcttgggtctcttccatcacggacaagacaaccctaacagatgtgatgaagaac
cacatcaccacggtgatgaagcagtacaagggcaaactctacgcctgggacgttgtcaat
gaaatcttcgaggaggatggtacccttcgtgacagtgtcttctccagggttcttggcgaa
gactttgttcggatcgccttcgaaacagctcgtgaggcagacccagaggcaaagctatac
atcaacgactacaacctggactccgccactagcgctaaattgcagggtatggtcagccac
gtcaagaagtggattgctgccggtgtccccatcgacggaattggctctcaaacccaccta
ggcgctggtgccggtgccgcagcttctggatctcttaatgctctcgccagtgcaggaacg
gaggaggtcgctgtcaccgagcttgatattgctggcgccagctctactgactacgtagat
gttgtcaatgcttgtctggaccagcccaagtgtgtcggaatcaccgtttggggagttgct
gacccggattcgtggcgtgccgacgagagcccattgctcttcgacgccagctataacccc
aaggaggcctacaacgctatcgcagctgctctctag

DBGET integrated database retrieval system