KEGG   Penicillium chrysogenum: Pc20g08180Help
Entry
Pc20g08180        CDS       T01091                                 

Definition
Pc20g08180
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Pc20g08180
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Pc20g08180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 404 aa AA seqDB search
MGPRIKRRRLTDSEDVSDDICQPASRLEKDSWNGFCEIESEPALFNVMLREFGVKGVKIQ
EVVSLDEEMMAFLNKPVYGLIFLFRWREDNDGKQEATCPDGLWFANQTANNACASVALLN
IVNNIPDIDLGENLRSFKEFTMPFTPALRGDAINNFEFVKRIHNSYARKMDILNSDLQLK
TEATTKKKGSKGQTPDESDATFHFIAFMPVMGQLWKFDGLERQPRALGECSENDWLELVK
PNLLDRMAAYEEEEIEFSILGLVRDPLPDLINDLAVNVRSLEILNQRATSLCPSSDTLAL
DETVLGPEPSLSLTREEIDAAVIPAETLDDYQTCSDEKLQEYQQTISRSQRELRTRIREE
QQSHRSDDEYAAGRRFDYGPAVRTWLRRLAQKQQLQELSALVAY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctcgaatcaaaaggcgccgtctgacggattcagaagatgtcagtgacgatatc
tgccagcctgcgtcccgtctagaaaaagacagctggaatggattttgcgaaatcgaatca
gaaccggccttgtttaatgttatgctacgtgaatttggggtcaaaggtgtaaagatccaa
gaagtcgtttctctcgatgaagaaatgatggcattcctcaataaacctgtctacggcttg
atctttctcttccgctggcgtgaagataatgatggaaagcaggaagcgacttgccctgat
gggctgtggttcgcaaaccagaccgccaacaatgcctgtgccagcgtagcactactaaac
attgtcaacaacatcccagatattgatctaggagagaatctgcggtccttcaaggaattc
accatgcctttcaccccagccctacgtggagatgcaatcaacaactttgaatttgtcaaa
aggatacacaactcatatgcacgaaaaatggacattctcaattcagatctacagctcaag
actgaagctaccactaagaaaaaggggtccaagggccagactcctgatgaatcggatgcc
accttccatttcattgcatttatgcctgtgatgggccagctgtggaagtttgatggcctg
gagcgacagccacgagcacttggggaatgttctgaaaacgactggctggaactggtcaag
cccaatcttctggaccgaatggctgcatacgaagaagaagaaattgaattctcaatttta
ggactcgtgcgggaccctctgccggatctcatcaacgacttggctgtcaacgtgaggagc
ttggaaattctcaaccagcgtgccacatccctgtgcccatcatcagacacactcgctttg
gatgaaactgtacttggtcctgaaccttccctatctctgacacgtgaagagatcgacgcg
gccgtgatccccgcggaaaccctcgatgattaccagacatgttccgatgagaagttgcag
gagtatcagcagacgataagtaggagtcagcgagaacttcgtacacgcattcgagaagag
cagcagtctcatcggtcggatgacgagtatgcagccggacggcgatttgactatggaccg
gcggtacggacatggcttcgacgcttggcacagaagcagcaactgcaggagctgtccgcc
ctcgtggcttactga

DBGET integrated database retrieval system