KEGG   Penicillium chrysogenum: Pc20g08310Help
Entry
Pc20g08310        CDS       T01091                                 

Definition
Pc20g08310
Orthology
K01115  
phospholipase D1/2 [EC:3.1.4.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Endocytosis
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pcs00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:pcs00565]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pcs04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1800 aa AA seqDB search
MSASSIHQDVETGSLKVDTKKQEPLLASNKSKLASPLPSSTESNKAASTKQTQPTDDHET
GGILGDKENARPSSLKQSSPRGRSSLSTRPPNRSAEDPQSWSRHQHQSSNPGMSPPSRAQ
SVQFRDTDTEAPDASHSRSQSRPVSEHGDDDDQGPKGKQSLFGKLKLLATAPNFTSHSRS
PSGASTDFRPAPGDIATPGSERGEFRFPEPLQEEGSEIDADAEESGGEQRDTREKRKTQR
RRKQWEEEAGSNTAPTTPKTTRRPSFHFSSSFAPFENYRTNLFPRRASTTDFTPQQREGV
SEDEGRERLSRRMRSRPWANTRVSSYTDRPDANPDEQRPSNLRRLTGFAGPSGNDESLTA
SWRRHRTERGTSASAQRWKQIKAGLKLIGQRRRPDNAVDNKKSAELLAELASAVPAALIL
ASAFQRDEHGSKRIPILLEQLKVRVTDSRIDSHSGDRHLVFRIEMEYGSGMTRMKWIIFR
TLRDFANLHLKYKLHLGTQKYIQLRTSENSPSLPRFPRSAFPYMRGVRGLESEFEDEDEE
GGYETGAEGMSGTERPPTKKKQNQQSHQRRVSGPLARRKSSITNQEGDSAAGPSSTHEGV
SGARKETYPGKQRKKLELYLQKMIRFLIFRADSNRLCKFLELSALGVRLAAEGSYHGKEG
FLIIQSSKGLDFRKALTPSLVKNRHSPKWFLVRHSYVVCVDSPEEMNIYDVFLVDSYFKI
QTPKLSLRKQNPKDLAKSAKQSARHPQHHTLRLENSERKLKLLARNERQLQQFEDSIRFM
VANTPWLRPNRFDSFAPVRQNCFAQWLVDARDHMWVVSRAINQAKDVIYIHDWWLSPELY
MRRPAAISQKWRLDRLLQQKAREGVKVFVIMYRNINSAIPIDSEYSKFSLLDLHPNIFVQ
RSPNQFRQNTFFWAHHEKLCLIDHTIAFVGGIDLCFGRWDTPQHQLTDDKPTGFETTDGP
KDADHCQLWPGKDYSNPRIQDFYDLDKPYEEMYDRNVVPRMPWHDISMHVVGQPARDLTR
HFVQRWNYILRQRKPTRPTPFLLPPPDFNPADLEALGLDGTCEVQILRSSSMWSTGTPDV
VEHSIMNAYVKLIEESEHFVYIENQFFISTCEIEGRKIENLIGDALVERIVRAAKNEEAW
RAVIVIPLMPGFQNTVDSEGGTSVRLIMQCQYRSICRGETSIFGRLRALGIEPEDYIQFY
SLRTWGKIGPHKALVTEQLYIHAKCMIVDDRAAIIGSANINERSMLGSRDSEVASVVRDT
DMMMSSMNGKPYLVGRFPHTLRMRLMREHLGIDVDELMEHDFATEEELRKIQVAEGSEHP
VDNRERRNSASSAIERQDEREMVERRHRVQDEFLSRSEDMYSFNHDVDWEQGGNPNLKSN
RKLTADPRVTENPDHRKDVEGDGPDHLTAAAQAGLTVGRDSEMETNGREALLSPIAPEGK
GTIERPRSSQQKPPGTPSTRKDRRPGTSSETNASSESNGNVPSQGHGFTGSSNRESETGG
TSLNTPREDNETLKHHHPSVPEVKRIFIDNDCMRDPIIDGFYLDTWQAVAEKNTKIYRSV
FRCMPDSEVKNWKEYKEYATYGERFAEVQSQQGNRTAQPQPKQNGPPPAGATVGSPMSIA
SQMSFITPRAEGPQADPKSPQGIEEKVGSGNETGRPQSEQLAKQETLSSIDEKAALKTVS
DPNLLANVSNGTSDENGVATGEDMEKSRTTPGHVDYSEAVNLNLNSSSQSRRRRRRATTI
GSKRDPHGADEYLDKGRAEDLLSNTQGHLILWPYDWLEKEEQGGNWLYALDQISPLEIYN
NT seq 5403 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcttcaattcaccaggatgtggaaactggctcattgaaggtcgacacaaag
aagcaagagccccttttagcttcgaacaaatcaaaattggcatccccgttgccttcttcc
actgaatccaacaaagcggcctcgaccaagcagacccagcccacggacgatcatgaaaca
ggtggaatactaggcgacaaggaaaatgcgcgtccatcatctttgaagcagagctcacca
aggggcaggtcatccctaagcactcgaccaccaaaccggtcagccgaggatccccagtca
tggagtcgccatcaacaccagtcgtccaaccctggaatgtcccctccatctcgtgcccaa
agtgtacaattcagagatacggacaccgaggctcccgatgcatcccactcccggtcgcaa
tcgcgacccgtttctgaacacggtgacgatgatgatcagggtcccaaaggaaagcagtcg
ttgttcggcaaactgaagttactcgctaccgcgcccaattttacatcacactcaagatcc
cccagcggtgcaagtacggacttccgcccagctccaggcgatatagctactccggggtcg
gaaaggggggaattccgcttcccagagccactgcaagaagagggcagcgagatcgatgcc
gatgcggaagagagcggcggcgagcaacgtgatactcgtgaaaaaagaaaaacgcaacgg
cggcggaagcaatgggaggaggaagctggctccaacaccgcccctacaacgcctaaaacg
acacgcagaccatcattccacttctcatcctccttcgcaccttttgagaactaccgtact
aatctgtttccccgaagagcaagcactacagacttcacacctcaacagcgcgaaggtgtt
tcagaagacgaaggccgtgagaggctcagccggcggatgaggagccggccatgggcaaat
actcgggtttccagctatacagaccgcccagacgccaatccggacgaacagcgtccgagc
aacctgaggcgattgaccgggtttgcgggaccatctggaaacgatgaaagcttgacggcg
agctggagacgccatcgaaccgagcgaggcaccagtgccagtgctcagcgatggaagcaa
atcaaagctggtctgaaactcattgggcagcgacgaagaccagataacgcagtggacaat
aaaaagtccgcagagttgcttgctgaactcgcttcggccgtacctgctgcgcttatactg
gccagcgcgttccaacgagatgagcacggcagcaagagaatcccgattcttttggagcag
ttgaaggtccgtgttacggacagccggattgattcccactccggtgatcgtcatctggtc
ttccgaatcgaaatggagtacggaagtggcatgactcgcatgaaatggatcatcttccgc
acgctaagagactttgccaatctgcatctgaagtataagcttcatctgggtactcagaag
tacattcagctgcgaacgagtgagaacagcccgagtctccctcgattccctagaagtgcc
ttcccttacatgcgaggtgtacgaggccttgaaagtgagttcgaggacgaagatgaagag
ggtggctatgagactggtgcggagggaatgagtggaacagagaggcccccgacgaagaaa
aagcagaaccaacaatcacaccagcgtcgggtatctggtccgcttgctcgcagaaagtcg
agtatcaccaatcaagaaggagactcagccgcaggaccttcatctacccatgaaggtgtt
tcgggagccaggaaagaaacataccctgggaagcagcgaaagaagcttgagctctatcta
cagaagatgattaggttcttgatcttcagggctgacagcaatcgcctgtgtaagtttttg
gagctgtccgctctcggtgtccgtctagccgccgaaggcagctatcatggcaaagaagga
ttcctgataatccagtcctccaagggtcttgatttccgaaaggcgctcaccccgtctctg
gtcaagaatcgccactcacccaagtggttcttggtcagacacagctatgtagtctgcgtc
gactctcccgaggagatgaatatttatgatgtcttcttggtggattcctatttcaagatc
cagacaccgaagcttagtcttcgcaagcaaaatccaaaggatcttgccaagtctgcaaag
cagtctgcgagacatcctcagcaccacactctccggcttgagaactctgagcgcaagctc
aaactgctggcccggaatgagcgccaactgcaacagtttgaagactcgattcgcttcatg
gttgctaacactccgtggctgcgccccaaccggttcgacagtttcgcgcctgtgcgacaa
aactgctttgcacagtggctggttgatgcgcgagaccacatgtgggtcgtctcgcgagca
attaaccaggcgaaggatgtcatttatatccacgactggtggctgagtccagagctttac
atgcgtcggcctgctgccatcagccagaaatggcgattggaccgtctcctgcaacagaaa
gcccgagaaggcgtcaaagtcttcgtgatcatgtatcgcaacatcaactccgccattccc
attgattcggaatattccaaattctctctccttgatcttcatcccaacatcttcgttcag
cgatcaccaaatcagttccgccaaaatactttcttctgggcccaccatgagaagctttgt
ctcatcgaccacactatcgcattcgttggaggtatcgatctgtgctttgggcgttgggat
actcctcaacatcaattgaccgatgacaagcctaccgggtttgaaactactgatggcccc
aaagatgcagatcattgtcaactttggccgggcaaggactactccaatcctagaatccaa
gacttctatgacctggataagccgtatgaggagatgtatgatcgcaatgttgtgccccgg
atgccgtggcatgacatctctatgcatgtcgtgggccaacctgctcgggatcttactcgt
catttcgttcaacgctggaattacattcttcgccagcgaaagcccacgcggccgacgcct
ttcctcttgccaccacccgatttcaatcccgctgatttagaagctttgggtcttgatgga
acttgcgaggtacaaatcctccgttctagcagcatgtggtcgacaggaacacccgatgtc
gtcgagcacagcatcatgaatgcctatgtgaagttgattgaggaatccgagcatttcgtc
tacatcgagaatcagttcttcatcagcacctgcgagattgagggccgaaagatcgagaac
ctcattggagatgccctagtggaacgtattgtccgcgctgccaaaaatgaggaagcatgg
cgcgccgtcattgtcatcccattgatgccaggcttccagaacaccgtggacagcgaaggt
ggaacaagtgttcgtcttatcatgcagtgtcaataccgcagtatctgtcgcggagagaca
tctatttttggccgtcttcgtgctcttggaatcgagccagaggattatatccagttctac
agcctgcgaacatggggcaagattggaccccacaaggcactggtgactgaacaactttac
attcacgccaaatgcatgattgttgacgatcgtgccgctatcattggatcagcaaacatc
aacgaacgatccatgttgggttcgcgtgattcagaggttgcgtctgtcgtgcgagacacc
gatatgatgatgtcgagtatgaatggcaagccataccttgtaggtcgattcccacatacc
ttgcgtatgcgtttgatgagagaacatctcggaattgatgtcgacgaactcatggaacat
gactttgctaccgaagaagagctacgcaagatccaggtcgccgaggggagcgagcaccca
gttgacaaccgagagcgaagaaattcggcatcctcggccattgaacgacaagatgagagg
gaaatggtcgaacgtcggcatcgtgtccaggatgagttcctttctcgctctgaggacatg
tatagcttcaaccatgatgtcgattgggagcagggtggtaaccctaacctcaagtcgaac
cgcaagctcaccgccgatcctcgcgtcactgaaaatcctgaccacaggaaagacgtggaa
ggtgatggccccgatcatctgacagccgctgctcaggccggattaacagtcggtcgtgat
tcagagatggagaccaatggaagggaagccctgctttcacctattgctcctgaggggaag
ggtactattgagcgaccgagatcatcgcagcaaaagccccctggaacaccctcgacccgc
aaggaccgcaggcctgggacatcgagtgagaccaatgccagctctgagagcaatggcaat
gtgccgtcgcaaggccatggatttactgggtcatcgaaccgcgagtccgagacgggcggt
accagtttgaacacgccaagagaagacaatgaaaccctcaagcaccaccacccgtctgtt
cccgaagtcaagcgtatcttcatcgataacgactgcatgagggacccgatcatcgatggc
ttctatctggacacgtggcaagccgtcgccgagaagaacactaagatttaccgatctgtg
ttccgctgtatgcccgacagcgaggtgaagaactggaaggaatacaaagagtatgccaca
tatggcgagcgctttgcagaggtgcagagccaacagggcaacaggacagcccaacctcaa
ccaaaacaaaatggtcctcctccagccggtgctacggtcggctctcctatgtcgatcgct
tctcagatgtctttcattaccccaagggcggaaggaccacaggcagacccgaagagcccc
cagggcattgaggagaaagtcggaagtggcaacgaaactggtcgtcctcaatctgagcag
ctagcgaaacaagagacgttatcgtctatagatgagaaggccgcactcaagacggtgtcg
gatccgaacctgttggccaatgtttcgaacgggaccagcgacgaaaatggcgtcgccact
ggtgaggatatggagaagtcacggacaaccccgggtcatgtcgattactctgaagctgtg
aatctgaatttgaactcgtcgagccagtctcggagacgtagacgcagagctacaacgatt
ggctcaaagcgtgaccctcatggcgcagatgagtatttggataagggtcgtgcagaggac
ctccttagcaatactcaaggccatctcatcttgtggccttatgactggcttgagaaagag
gaacaaggtggaaactggctctacgctttggaccagatttctcctctggagatctacaac
taa

DBGET integrated database retrieval system