KEGG   Penicillium chrysogenum: Pc20g08550Help
Entry
Pc20g08550        CDS       T01091                                 

Definition
Pc20g08550
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 236 aa AA seqDB search
MAWYCSGSTNTELIENLFKAGLIRDERVKDAMIGVDRAHYAPSRAYSDSPQPIGHGATIS
APHMHGHACEYLIDYLKPGSRVLDIGSGSGYLTHVLANLVTSPGNQGQVIGIDHITELTD
LARTNMDKSKTGSELLASQTVKFITGDGRLGWKEGAPYDAIHVGAAADKLHPTLVDQLRA
PGRLFIPVETEDDENDRDSISGGQYIWVVDKKEDGSIHKEKVFQVSYVPLTDAPKG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtactgttctggatccaccaacaccgagttgatcgagaacctattcaaggct
ggactgatccgcgatgagcgtgtgaaagatgccatgataggagttgatcgagcccattat
gccccatcaagggcgtattcagactcgcctcaacccattggacatggggccacaatatca
gcaccgcacatgcatggccatgcatgtgagtatctgattgattatctcaaaccaggctct
agggtgttggatattggatctggttcgggatacttgacccacgtccttgccaatctggtg
accagccctggcaaccagggacaggtgattggcattgaccatatcaccgagctgacagat
ctggctcgtaccaacatggacaagtccaagacaggtagtgagttactggcatcgcaaact
gtcaagtttatcactggcgatggacgtcttggatggaaagaaggtgcaccatacgacgcc
atccacgttggtgccgcggccgacaagcttcatcccactctggtggaccagctgcgtgct
cctgggcggctttttattccggtggaaaccgaagacgacgagaatgacagggatagtatc
agcggaggtcaatatatttgggtggtggataaaaaggaagacggatccattcacaaggag
aaggtcttccaggtgagttatgtgcccttgacggatgctccaaaaggatga

DBGET integrated database retrieval system