KEGG   Penicillium rubens: Pc20g08550Help
Entry
Pc20g08550        CDS       T01091                                 

Definition
(RefSeq) Pc20g08550
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pcs  Penicillium rubens
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pc20g08550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_32 Methyltransf_11 Methyltransf_23 MetW MTS Methyltransf_12 GCD14 Ubie_methyltran Methyltransf_18 PrmA FtsJ CMAS RrnaAD
Motif
Other DBs
NCBI-GeneID: 8304194
NCBI-ProteinID: XP_002563378
UniProt: B6HEY5
AA seq 236 aa AA seqDB search
MAWYCSGSTNTELIENLFKAGLIRDERVKDAMIGVDRAHYAPSRAYSDSPQPIGHGATIS
APHMHGHACEYLIDYLKPGSRVLDIGSGSGYLTHVLANLVTSPGNQGQVIGIDHITELTD
LARTNMDKSKTGSELLASQTVKFITGDGRLGWKEGAPYDAIHVGAAADKLHPTLVDQLRA
PGRLFIPVETEDDENDRDSISGGQYIWVVDKKEDGSIHKEKVFQVSYVPLTDAPKG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtactgttctggatccaccaacaccgagttgatcgagaacctattcaaggct
ggactgatccgcgatgagcgtgtgaaagatgccatgataggagttgatcgagcccattat
gccccatcaagggcgtattcagactcgcctcaacccattggacatggggccacaatatca
gcaccgcacatgcatggccatgcatgtgagtatctgattgattatctcaaaccaggctct
agggtgttggatattggatctggttcgggatacttgacccacgtccttgccaatctggtg
accagccctggcaaccagggacaggtgattggcattgaccatatcaccgagctgacagat
ctggctcgtaccaacatggacaagtccaagacaggtagtgagttactggcatcgcaaact
gtcaagtttatcactggcgatggacgtcttggatggaaagaaggtgcaccatacgacgcc
atccacgttggtgccgcggccgacaagcttcatcccactctggtggaccagctgcgtgct
cctgggcggctttttattccggtggaaaccgaagacgacgagaatgacagggatagtatc
agcggaggtcaatatatttgggtggtggataaaaaggaagacggatccattcacaaggag
aaggtcttccaggtgagttatgtgcccttgacggatgctccaaaaggatga

DBGET integrated database retrieval system