KEGG   Penicillium chrysogenum: Pc20g08570Help
Entry
Pc20g08570        CDS       T01091                                 

Definition
Pc20g08570
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcs  Penicillium chrysogenum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pcs01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pcs00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pcs00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 459 aa AA seqDB search
MASRISIARLSGQRFSAVARTPRASSQFRNVRGLSTLTRKTSARSASGLLQVSSSGINVS
RLNIAPLGGHQLRTYADSIIKVPSMAESITEGTLKQFSKQVGDFVERDEEIATIETDKID
VSVNAPESGTIKEFLVNEEDTVTVGQDLVKLELGAAPEGGKKDEGAEKPKEPEPKESEPK
KDASPAPAEAEKPKEPEPKKAAPPKEAPKAESKPQAAEQPALGDREERRVKMNRMRLRIA
ERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDILKKTGVKLGFMSAFSRACVLAMKDI
PAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNTEGKDLVGIEKAIADLGKK
ARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINVPQTAVLGLHAIKDKPVAVNGKVEIR
PMMYLALTYDHRLLDGREAVTFLVKIKEYIEDPRRMLLG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcggatctctattgcgcgcctctcgggccagcgcttctcggctgtggccaga
actcctcgggcatcaagccagttccgcaatgtcaggggattgtctacccttacgcggaag
acttctgctcgctcagcttcgggcctgttgcaggtctcttcctcaggcatcaatgtctcg
cgactcaacattgctcctcttggaggccaccaacttcgcacctatgccgactccatcatc
aaggtccctagcatggctgagtcgattacagagggtaccctcaagcagttctcaaaacag
gttggtgattttgtcgagcgcgacgaggagattgcgacaattgaaacagacaagattgat
gtttcggtcaatgccccggaatctggtaccatcaaggagttccttgtgaacgaggaagac
actgttactgtcggacaggatcttgtcaagcttgagcttggcgccgctcccgaaggcgga
aagaaggacgagggtgccgaaaaaccaaaggagcccgaacccaaggagtctgagcccaag
aaggatgcttcgcccgcccctgccgaggccgagaagcccaaggagcccgaacctaagaag
gctgcgccccccaaggaagcccccaaggcggagtctaagccccaagctgctgaacagcca
gctcttggtgaccgtgaggaacgccgggttaaaatgaaccgtatgcgtctgcgtattgcc
gagcgcctgaagcagtcccagaacaccgccgcttctctcaccactttcaacgaggttgac
atgtcctcgctgatggagttccggaagctatacaaggatgatatcctcaagaagaccggt
gtgaagcttggcttcatgagcgccttctcccgtgcttgtgtgcttgccatgaaggatatc
cccgctgtcaacgcttccattgagggtcctaacggcggtgacaccattgtctaccgcgac
tatgttgacatcagtgttgcagttgccaccgagaagggtcttgtgactcctgttgtccgt
aacacggaaggcaaggatcttgttggaatcgagaaggccattgccgatctcggaaagaag
gctcgtgacaacaagttgaccattgaagacatggccggtggtaccttcaccatcagcaac
ggtggtgtcttcggttcgctgatgggcaccccaatcatcaacgttcctcaaacagctgtc
ttgggtcttcacgccatcaaggacaagcctgtcgctgtgaacggcaaggtcgagatccgt
cccatgatgtatctggccctcacctacgatcaccgtcttctggatggtcgtgaggccgtt
actttccttgtcaagatcaaggagtacattgaggacccccgacgcatgctgcttggttag

DBGET integrated database retrieval system