KEGG   Penicillium chrysogenum: Pc20g08600Help
Entry
Pc20g08600        CDS       T01091                                 

Definition
Pc20g08600
Orthology
K11252  
histone H2B
Organism
pcs  Penicillium chrysogenum
Brite
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Pc20g08600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 141 aa AA seqDB search
MPPKAAEKKPSTGGKAPVGGKAPAEKKEAGKKTATAATGEKKKRGKTRKETYSSYIYKVL
KQVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGE
LAKHAVSEGTKAVTKYSSSAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaaggccgctgagaagaagccctccaccggtggcaaggcccccgttggcggc
aaggcccctgctgagaagaaggaggctggcaagaagactgccaccgctgccactggcgag
aagaagaagcgcggcaagacccgtaaggagacgtactcttcttacatctacaaggtcctc
aagcaggtccaccctgacactggtatctccactcgtgccatgtccatcttgaactccttt
gtcaatgacattttcgagcgtgtcgctacggaggcctccaagctggctgcgtacaacaag
aagtctaccatctcctcccgggagatccagacctcggtccgcctgatcctccccggtgag
ctggccaagcacgccgtctctgagggcaccaaggctgtgaccaagtactcttcttccgcc
aaataa

DBGET integrated database retrieval system