KEGG   Penicillium chrysogenum: Pc20g10360Help
Entry
Pc20g10360        CDS       T01091                                 

Gene name
hex
Definition
beta-N-acetylhexosaminidase hex-Penicillium chrysogenum
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pcs  Penicillium chrysogenum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pc20g10360 (hex)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Pc20g10360 (hex)
   00603 Glycosphingolipid biosynthesis - globo series
    Pc20g10360 (hex)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Pc20g10360 (hex)
   00511 Other glycan degradation
    Pc20g10360 (hex)
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pc20g10360 (hex)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 596 aa AA seqDB search
MKFASVLNVLGALTAASAVQVNPLPAPRNITWGSSGPIQVNNLNLNGPHSPLLTQAWERA
WETITTLQWVPAAVESPIASYPAFPTSTPVSSAPKAKRAPSGIHNVDVHVVDNDADLQYG
VDESYTLVVSDGGIRINSQTVWGVLQAFTTLQQIIISDGKGGLIIEQPVKIKDAPLYPHR
GIMIDTGRNFITVRKLLEQIDGMALSKLNVLHWHLDDSQSWPMQMSSYPEMTKDAYSPRE
IYTEHDMRRVIAYARARGVRVIPEVDMPAHSASGWQQVDPEIVACAESWWSNDVWAEHTA
VQPNPGQLDIIYPKTYEVVNNVYQELSRIFSDNLFHVGADEIQPNCYNYSTHITKWFAED
PSRTYNDLAQYWVDHSMPIFRSVGDHRRLMMWEDIAIATESAHDVPKDVIMQTWNSGEGE
GNIKKLTSAGYDVVVSTSDFLYLDCGRGGYVTNDARYNVQSNTDGGVNFNYGGDGGSWCA
PYKTWQRIYDYDFLTNLTSSEAKHIIGAEAPLWSEQVDDVTVSSVFWPRAAALGELVWSG
NRDAAGRKRTTSFTQRILNFREYLVANGVMATALVPKYCLQHPHACDLYKNQTVMS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcctcggtgttgaatgtgctcggggccctgacggctgcgtccgccgtccaa
gtgaatccacttcccgccccccgtaacatcacctggggatcctccggtccaatccaagtc
aacaacttgaatctcaacggtcctcactcccctttgctcactcaagcttgggagcgagca
tgggaaaccatcaccaccctgcaatgggttcctgctgctgttgaatccccaatcgcctcc
tatccggccttccccacctcgacccctgtctcctctgcccccaaggccaaacgcgcgccc
tccggaatccataacgtcgatgttcatgtggtggacaacgatgccgatctccaatacggt
gtggatgaatcctatacactggtagtgagcgatggtggcatcaggatcaattctcagacg
gtctggggtgtgttgcaggcattcaccaccctgcagcagattatcatctcggatgggaag
ggcggtttgatcattgaacagcccgtcaagatcaaggatgccccgctgtacccccatcgt
ggtatcatgatagacaccgggcgcaacttcattaccgttcgcaagctccttgagcagatc
gacggtatggccctgtccaagctcaatgttctccactggcacttggacgattctcagtcg
tggcccatgcagatgagctcctacccggagatgaccaaagatgcttactcgcctcgcgaa
atctacaccgagcacgacatgcgccgcgtgattgcctacgcacgcgcgcgaggtgtccgc
gtcatccccgaggtcgacatgcccgcccactcagcctccggctggcagcaggtcgacccg
gagatcgtggcatgtgccgaatcctggtggtcgaacgacgtttgggcggagcacaccgcc
gtccagccgaaccctggccagctcgacattatctaccccaagacctacgaagttgtcaac
aatgtctaccaggaattgtctcgcatcttcagcgacaacttgttccacgttggtgcagac
gagatccagcccaactgctacaactacagcacccatatcactaagtggtttgccgaggat
ccctcgcgcacctacaacgaccttgcgcagtactgggttgaccattccatgcccatcttc
cgtagtgtcggcgaccaccgccgtcttatgatgtgggaggacatagctatcgcgactgaa
agcgcccacgacgtgcccaaagacgtcatcatgcagacctggaacagcggcgagggtgag
ggtaacatcaagaaactcacctccgccggctacgacgttgtcgtttcgacctccgatttc
ctctacctcgactgcgggcgcggcggctatgtcaccaacgacgcccgctacaacgtgcag
agcaacaccgacggcggagtgaacttcaactacggcggcgacggtggctcctggtgcgcc
ccctacaagacctggcagcgcatctacgactacgacttcctcacgaatctcacttcctcc
gaagcgaagcacattatcggcgccgaggctcctttgtggtcggagcaggtcgacgatgtg
accgtctccagcgtgttctggcctcgcgctgctgctctgggtgagcttgtctggtctggt
aaccgtgacgctgcgggtagaaagcgtaccaccagctttactcagcgtattctgaacttc
cgtgaatacctcgttgccaatggtgtgatggctactgctcttgtgccgaagtattgtctg
cagcaccctcatgcttgcgacctctataaaaaccagactgtaatgtcttga

DBGET integrated database retrieval system