KEGG   Penicillium chrysogenum: Pc20g11890Help
Entry
Pc20g11890        CDS       T01091                                 

Definition
Pc20g11890
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pcs  Penicillium chrysogenum
Brite
Protein phosphatases and associated proteins [BR:pcs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Pc20g11890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 196 aa AA seqDB search
MDQPPSPNEPNAAAIYDARRRRGSVGTTQLFDNIVSTSNFNRDEVDRLRKRFMKLDKNAS
GTIDRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVTGLSAFSSKGNKQEKLRFA
FKVYDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDQDGKISFEEFTD
MVENTDVSLSMTLSMF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccgccctcccccaatgagcccaacgctgctgcaatttacgatgcgcggaga
cgccgaggctccgtgggtaccacccagctcttcgataacattgtgtctacctccaacttc
aaccgggacgaggtggatcgcctgcgcaagcgcttcatgaagctggataagaatgcctcc
ggcactatcgaccgtgatgagttcctctcccttccccaagtgtcgtccaacccgctcgcc
acgagaatgattgccatcttcgatgaagacggtggcggtgacgtggacttccaggaattc
gtgaccggcctgtcagcattcagctcaaagggcaacaagcaagagaaactgcgattcgca
ttcaaggtgtacgacattgaccgtgacggctacatttccaacggcgagctgttcattgtg
ctgaagatgatggtcggcaataacctcaaggacgtgcagctgcagcagatcgtcgacaag
acgatcatggaggctgataaggatcaggatggaaagatcagcttcgaggagttcacggat
atggttgagaatacagacgtgagcctcagtatgacactgagtatgttttga

DBGET integrated database retrieval system