KEGG   Penicillium chrysogenum: Pc20g13370Help
Entry
Pc20g13370        CDS       T01091                                 

Definition
Pc20g13370
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pc20g13370
   00500 Starch and sucrose metabolism
    Pc20g13370
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Pc20g13370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 322 aa AA seqDB search
MYPYNFLLTALSLGTAVLAAPAELVTRTARTSAPLGCLTVGSNGKYSTIGDALTALGSSS
APACIYVASGTYEEQITINYAGALTLYGETADTETYKENTVTITHTISSPQAGSLDKSAT
VNVVADGFKMHNINVVNGFRKGAQAVALVANADKLSFYACQFSGYQDTLYAKAGKQYYAN
SKVEGAVDYIFGAASAWFNNCDIVSNGPGAITASSRQTTTDTTWYAFDDCTVKASSSAIE
DGTVFLGRPWRVLARVIFQNSSLRSVVNPKGWTTMADGATPLYYEYNNSGAGSDTSERQF
ETPISAAIAKQTVLGSDYATWI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatacaatttcctcctcacagccctatcattggggacggctgtcctggccgca
cccgccgaactagtcactcgcacagccaggactagtgcccccttaggttgcctgacagtc
ggttctaacgggaagtactcgactatcggcgatgccctgactgccctcggctcttcctca
gcgccggcttgtatctatgtcgctagtggcacgtacgaggaacagattactatcaactat
gccggtgctctgactctgtatggtgagactgccgatacggagacgtacaaggagaacact
gttaccattacccacaccatctcttcgccacaggctggctcgctggataagagtgctact
gtgaatgttgtcgccgatgggttcaagatgcacaatatcaatgtggtgaacgggttccgg
aaaggtgcacaggccgttgcactcgttgccaatgccgataaactcagcttctatgcatgc
cagttctctggataccaggataccctgtacgccaaggcgggaaaacaatactatgccaat
agcaaggttgagggagccgtggactatatctttggcgctgcctctgcctggttcaacaac
tgcgacatcgtctccaacggccctggcgccataaccgccagttcacgccagacaaccacc
gacacgacctggtatgcatttgacgactgcactgtcaaggcttcgtcaagtgctatcgag
gatggcactgtattccttggccgtccgtggcgagtccttgctcgcgtcatcttccagaac
tccagcctgcgtagtgtggtcaatcccaagggatggacgacaatggcggacggagctaca
ccactctattatgagtataataattcgggggctgggtcggatacttctgagcgccagttc
gagactcctatctcggcagcaatagcgaagcagactgttttgggaagtgattatgctact
tggatttga

DBGET integrated database retrieval system