KEGG   Penicillium rubens: Pc20g13550Help
Entry
Pc20g13550        CDS       T01091                                 

Definition
(RefSeq) Pc20g13550
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pcs  Penicillium rubens
Pathway
pcs00620  Pyruvate metabolism
pcs00630  Glyoxylate and dicarboxylate metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01200  Carbon metabolism
Module
pcs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pc20g13550
   00630 Glyoxylate and dicarboxylate metabolism
    Pc20g13550
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pc20g13550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 8308596
NCBI-ProteinID: XP_002563834
UniProt: B6HGZ3
AA seq 539 aa AA seqDB search
MSHVDTQLKDVAILGSINNDARKILTKEACAFLALLHRTFNPTRKALLQRRIDRQAEIDK
GNLLDFLPQTKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVWTYMADFE
DSSAPTWDNMVNGQVNLYDAIRRQVDFKQGEKEYKLRTDRTLPTLIARARGWHLEEKHFT
VNGEAISGGLFDFGLYFFHNAKELVARGAGPYFYLPKMESHLEARLWNDVFNLSQDYIGM
PRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRNHPNFVLPDR
SDVTMTVPFMDSYVKLLIKTCHRRGVHAMGGMAAQIPIKNDPAANDKAMESVRADKLREV
RAGHDGTWVAHPALAAIASDVFNTHMPTPNQLFVRREDVNITANDLLNTNVPGKITEEGI
RKNLNIGLSYMEGWLRGVGCVPINFLMEDAATAEVSRSQLWQWTRHNVSTAEGKRMDKAF
ALRLLQEQADSLAAKGGKGNKYQLAARYFAGQVTGEDYADFLTSLLYNEISSAGSAAKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgtcgacacccagctcaaggatgtcgccatcctgggttccatcaataacgat
gctcgcaagatcctgaccaaggaggcatgtgcctttttggctctattgcaccgcaccttc
aaccccacccgcaaagctcttctccaacgccgcatcgatcgccaagctgagattgacaag
ggaaatcttctcgacttccttccccagactaagcacatccgtgagaatgacgcctggaag
ggtgctcctcccgctccaggtctcgtggaccgccgtgtcgagattactggccctaccgac
cggaagatggtggtgaacgcgctgaactccgatgtctggacttacatggctgatttcgag
gattcgagtgccccgacttgggacaacatggtgaacggtcaggtcaatctgtacgatgct
atccgccgacaggtcgacttcaagcagggcgagaaggagtacaagctccggactgaccgc
actctgcccactctgattgctcgtgctcgtggctggcacctggaggagaagcacttcacc
gtgaacggcgaagccatctccggtggtctcttcgatttcggtttgtacttcttccacaac
gccaaggagctggtcgcccgtggcgccggtccttacttctacctccccaagatggagtct
cacttggaggctcgtctctggaacgacgtcttcaacctctcccaggactacattggtatg
ccccgcggaaccatccgtggaactgtcctgattgagaccattactgccgcattcgagatg
gacgagatcatctacgagctgcgcgatcacagctccggcctcaactgcggccgctgggat
tacatcttctccttcatcaagaagttccgcaaccaccccaacttcgtccttcccgatcgc
tctgacgtcaccatgaccgtgcctttcatggattcctacgtgaagctcctcatcaagacc
tgccaccgtcgtggcgttcacgccatgggtggcatggccgcacagatccccatcaagaac
gaccccgccgccaacgacaaggccatggagagcgttcgcgctgacaagctgcgcgaagtg
cgcgccggccacgacggcacctgggttgcacaccctgcgcttgctgcgattgcctctgat
gtcttcaacacccacatgcccacccccaaccagctgttcgtccgccgtgaggatgtcaac
atcaccgccaacgacctcctcaacaccaacgtccctggcaagatcaccgaggaaggtatc
cgcaagaacctgaacatcggccttagctacatggaaggctggctccgcggcgtcggctgc
gtgcccattaacttcctcatggaggacgccgccacagccgaagtttcccgcagccagctg
tggcagtggacccgtcacaacgtcagcacagccgagggcaagcgcatggataaggccttt
gcgctgcgtcttctgcaggagcaggctgatagtctggcggctaagggtggcaagggcaat
aagtaccagcttgctgctcggtactttgccggccaggttactggtgaggactacgcggat
ttcttgaccagcttgctgtataacgagatctcctccgctggtagtgctgctaagctttga

DBGET integrated database retrieval system