KEGG   Penicillium chrysogenum: Pc20g14220Help
Entry
Pc20g14220        CDS       T01091                                 

Definition
Pc20g14220 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 438 aa AA seqDB search
MWKPSERLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKRVQDWYAQSFEEIITLPRPSLTQEVKARLLRPGRMNGGPSKILS
ETTQNPSVREGQYRSSVTAGNGNGVAKAHAAAGRRYFFPADDRGDWPPELNDYNQRFAKT
LQQIKRRHDGVVTTVAQGILEWKRARQRMQIDSTIQSFLDRFYMSRIGIRMLIGQHIALT
EQTHVKHPNYVGIICTKTNVRDIALEAIENARFVCEDYYGLFESPKVQLVCKEDLNFMYV
PGHLSHMLFETLKNSLRAVVEQHGADKDDFPVTKVIVAEGKEDITIKISDEGGGIPRSSI
PLVWTYMYTTVEQTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYG
TDVYLHLNRLSSSSEPLQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagccttcagagaggctgatggaaaccatcagacattatgccagcttccccgca
accggtgtctcgctgaggcagatggtccaatttggtgaccgtccctcaacaggtacccta
ttccgcgcctctcaatttctctctgaggaactcccgattcgtctcgcacatcgcgtgcag
gatctaggagagctaccagatggactcagtgagatgccgtcgatcaaaagggtccaggac
tggtatgcgcagtcatttgaggaaatcattactctccctcgccccagcctgactcaagaa
gtgaaagcacgcctgttacgaccaggccggatgaacggcggcccttcaaaaatcctctct
gaaacaacccaaaaccccagcgtgcgtgaaggacagtaccggtcatctgtgaccgcaggc
aatggaaatggcgttgcaaaagcgcacgccgccgcaggccgacggtactttttccccgcg
gacgaccgcggagactggccgccggaactcaacgactacaaccaacgattcgccaagact
ctccaacagatcaagcgccgccacgacggggttgtgaccacagttgcgcaaggcatcctg
gaatggaaacgtgcgcgacagcgcatgcagatcgactccacgattcagtccttcctcgat
cggttttacatgtcaagaattggtatacgaatgctcatcggtcaacacatcgcactcacg
gagcaaacgcacgtcaaacaccctaactatgttggaataatttgtaccaagaccaacgtt
cgtgacatcgcgctcgaggctattgaaaatgcccgcttcgtctgcgaggactactacggt
cttttcgagtcgcccaaggtgcagctggtctgcaaggaggacttgaacttcatgtatgtt
cccggacacctgtcgcacatgctcttcgagaccctcaagaactcgcttcgggcggtcgtc
gaacaacatggtgccgataaggatgatttccccgtgaccaaggtaatagttgcggaaggc
aaagaggacattacgatcaagatctccgacgagggcggtggtatcccccggtcgtcgatt
cctctcgtatggacctacatgtacacgacagtggagcaaacgcccaacctggaccctgat
ttcgacaagaacgacttcaaagcaccaatggctggatttggatatggcctgccaattagt
cgactgtacgcacggtactttggcggtgatctgaagttgatcagtatggagggctacggg
acggacgtctacctccacctcaatcgcctctcttcaagctcggagcctttgcaatga

DBGET integrated database retrieval system