KEGG   Penicillium chrysogenum: Pc20g14220Help
Entry
Pc20g14220        CDS       T01091                                 

Definition
Pc20g14220 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Pc20g14220
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Pc20g14220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 438 aa AA seqDB search
MWKPSERLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKRVQDWYAQSFEEIITLPRPSLTQEVKARLLRPGRMNGGPSKILS
ETTQNPSVREGQYRSSVTAGNGNGVAKAHAAAGRRYFFPADDRGDWPPELNDYNQRFAKT
LQQIKRRHDGVVTTVAQGILEWKRARQRMQIDSTIQSFLDRFYMSRIGIRMLIGQHIALT
EQTHVKHPNYVGIICTKTNVRDIALEAIENARFVCEDYYGLFESPKVQLVCKEDLNFMYV
PGHLSHMLFETLKNSLRAVVEQHGADKDDFPVTKVIVAEGKEDITIKISDEGGGIPRSSI
PLVWTYMYTTVEQTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYG
TDVYLHLNRLSSSSEPLQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagccttcagagaggctgatggaaaccatcagacattatgccagcttccccgca
accggtgtctcgctgaggcagatggtccaatttggtgaccgtccctcaacaggtacccta
ttccgcgcctctcaatttctctctgaggaactcccgattcgtctcgcacatcgcgtgcag
gatctaggagagctaccagatggactcagtgagatgccgtcgatcaaaagggtccaggac
tggtatgcgcagtcatttgaggaaatcattactctccctcgccccagcctgactcaagaa
gtgaaagcacgcctgttacgaccaggccggatgaacggcggcccttcaaaaatcctctct
gaaacaacccaaaaccccagcgtgcgtgaaggacagtaccggtcatctgtgaccgcaggc
aatggaaatggcgttgcaaaagcgcacgccgccgcaggccgacggtactttttccccgcg
gacgaccgcggagactggccgccggaactcaacgactacaaccaacgattcgccaagact
ctccaacagatcaagcgccgccacgacggggttgtgaccacagttgcgcaaggcatcctg
gaatggaaacgtgcgcgacagcgcatgcagatcgactccacgattcagtccttcctcgat
cggttttacatgtcaagaattggtatacgaatgctcatcggtcaacacatcgcactcacg
gagcaaacgcacgtcaaacaccctaactatgttggaataatttgtaccaagaccaacgtt
cgtgacatcgcgctcgaggctattgaaaatgcccgcttcgtctgcgaggactactacggt
cttttcgagtcgcccaaggtgcagctggtctgcaaggaggacttgaacttcatgtatgtt
cccggacacctgtcgcacatgctcttcgagaccctcaagaactcgcttcgggcggtcgtc
gaacaacatggtgccgataaggatgatttccccgtgaccaaggtaatagttgcggaaggc
aaagaggacattacgatcaagatctccgacgagggcggtggtatcccccggtcgtcgatt
cctctcgtatggacctacatgtacacgacagtggagcaaacgcccaacctggaccctgat
ttcgacaagaacgacttcaaagcaccaatggctggatttggatatggcctgccaattagt
cgactgtacgcacggtactttggcggtgatctgaagttgatcagtatggagggctacggg
acggacgtctacctccacctcaatcgcctctcttcaagctcggagcctttgcaatga

DBGET integrated database retrieval system