KEGG   Penicillium chrysogenum: Pc20g14310Help
Entry
Pc20g14310        CDS       T01091                                 

Definition
Pc20g14310
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Pc20g14310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 500 aa AA seqDB search
MASEAGWSCDANDAVHVTVIQPGEKKPKTLSTFHPEFTYPIFGDDEQIFGYKGLIIRLRF
AAHDLRPHVHISYDEKFKSVGDTAAVDLLDTLKPFVQKEAFANLQDYEQAVQNDPDAKDF
KPPGEFVIGYEVDDRKYEIWAGSLANPEVRKILDRMQVLVSLFIEAGTPLETNDPEWTLD
RWRVYFVYEKVTPPTPTASSYSIVGYATTYRYWYYQRDQSQTPTVKNDAFPPPEVNISEL
PARNRIAQFLILPSHHRAGHGTHLYTTIHAACIADPTILELTIEDPNEQFDALRDTADYC
LLRPEFLKHNVNLNPDPLGAYSQKKRPRNVPTSALIPTKLLHDIRKSFKIEPTQFAHVLE
MYLLGQIPQSHRLAGGTNLARLLIKKFKAENENDRRYYWWRMLTKQRLYKKHKELLNELE
LLDRVEKLDATVQNVEEGYEITLDALAGRLPEDESDEEAEANEQASKAPTGSRDRRAKRK
LTVMDDEEEDGTELAKRPKV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgaagctggatggtcttgcgacgccaacgatgcggtccatgttaccgtcatt
caacctggcgagaagaagccgaaaacactttcgacgttccacccggaattcacctatcct
atctttggtgacgacgagcaaatttttggctacaaaggcttaattatccgtttgcgtttt
gcggcccacgatttgcgccctcatgtacacatttcctacgacgagaagttcaagtccgtt
ggtgacacagctgctgtcgatcttctcgacactttgaaaccctttgtccaaaaagaggct
ttcgccaatctccaagactatgaacaagctgttcagaacgaccctgacgcgaaagatttc
aagcccccgggcgagtttgtcattggctacgaggtcgacgatagaaaatatgagatatgg
gctggatcgcttgcgaacccggaagtgcggaagattctggatcgtatgcaggttctcgtc
tccctcttcattgaagctggaacacccctagaaacgaatgacccagagtggacactcgac
cggtggagggtatacttcgtgtatgagaaggtgactcctccgacaccgacagcatcatca
tattcaatcgtcggatatgctacaacgtaccgttattggtattatcagcgggatcagtca
cagacccccacagtcaaaaacgacgcgttcccgccaccagaagtcaacatttcggagctt
cctgcacggaaccgtattgcccagtttctcattctcccttcacaccaccgcgccggccac
ggcactcatctatatacgacaatccacgcggcctgcatcgcagacccaaccattctagaa
ttaaccatcgaagaccccaatgaacagttcgacgcgttgcgggacacagctgattattgt
ctgctgcggccggagttcctgaagcacaatgtgaatctcaaccccgatcccctcggggcg
tattctcaaaagaagcgtcctcgcaatgtgcccacttctgccctcatccccaccaaactg
ctccacgacatccgcaaatcgttcaagatcgaacctacgcagttcgcacacgttctggag
atgtacctcctcggccagatccctcaaagccaccgcctggccggcggcacaaacctcgct
cgactgttgatcaagaagttcaaggccgaaaatgagaatgaccgacgctactactggtgg
cgtatgctaaccaagcagcgtctctacaaaaaacacaaagaacttttgaacgaactggag
cttctcgatcgggtggagaaacttgatgctacggtccaaaatgtggaggaaggttacgag
attacgttggatgcgctcgcgggccgcttgccagaagatgaatcggatgaagaggcagag
gccaacgagcaggctagcaaggctcctactggtagccgagaccgccgtgccaagcgcaag
ctcacggttatggatgatgaagaggaggatggaacagagctagctaagcgaccaaaggtt
taa

DBGET integrated database retrieval system