KEGG   Penicillium chrysogenum: Pc21g03230Help
Entry
Pc21g03230        CDS       T01091                                 

Definition
Pc21g03230
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Pc21g03230
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Pc21g03230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 701 aa AA seqDB search
MNTRDGRSETFFNRHDQYASRNSHYEIALATLQNNQPLAYILIALISIPILLGYLGLVPA
SLFELPWDLVVYFTPSRIVIALDPHISTSDPETLASSPLPLQDKSDAMKRILGLDNNVYF
PFFSRSKSLSIFGNTLLGDTKDVAPPGLGNWNNSCFQNSIIQGLASLKYLAEFLGHNVDN
LSGKAPISTHMALLDLIDRLNSASKSGTKLWISGPLKSMSSWQQQDAQEYFSKLLSQIDL
EAERCSRGETMNIGLKIAGPDENIFRDSDCDDPVAPWEPESLPSTDKLYLDRVSSCNPLE
GLLAQRVGCMECGWTEGLSLIPFNCLTVPLGKRPSYDVRECLDQYMALEPIEGVECAKCT
LLHRQDQLINLISGFEADESRPESPDEPQPLDAVKLSAHSRLEAVKTALDGNDFSENTLA
NKCHINSKNRTSTTKSRQAVIARAPRCLAIHINRSVFDEYTGTLEKNLATVTFPQMIDLN
NWCLGTQPLSKSGDNSEHWETNPSRSMLPQPGESIQVPSRHYQLRAIITHYGRHENGHYI
CYRKYPTSEFTAPAPDEILQAEGDKDKPERWWRLSDDDVQMVSEGHVMTQGGAFMLFYEA
VDDSVSPCSTRSATPEHDLYEKYAGSCQFESEESMCNSAMPKDTSPPSTVTDFESATSRE
TSISLPMDDLLPADQPLKTSNTIDADAERNAKLDSPSTVVA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccgcgacgggcgctctgagacttttttcaaccgccacgatcagtacgcaagc
cgcaacagtcattatgaaatcgccctcgcgactttacaaaacaatcaaccgctagcatac
attcttattgctctcatttcaattcctatccttctcggttacctcggactcgttcccgca
tcgctattcgagctcccttgggatctcgttgtctattttacgccctctcgaatcgttatc
gctttggaccctcacatatcgacctccgacccagagacgctagcttcgtcgcctttgccc
ttgcaagataaaagtgacgccatgaaacgtattcttggcttggacaacaacgtctacttt
cctttcttctccaggtcaaaatcactctctatcttcggaaatacgctgctgggggacacc
aaggatgtcgccccgccggggcttggaaactggaataactcgtgttttcagaacagcatc
atacagggattggcttctttgaaatatctcgccgaatttctggggcacaacgtggacaac
ctctcgggaaaagctcccatctcgacgcatatggcactactagacctcatcgaccgtctg
aatagcgcctccaaaagtggaaccaagctgtggatctctggacctctcaagtctatgagt
agctggcaacagcaagatgcgcaagaatatttttccaagttgcttagtcaaattgacctt
gaagccgagcgctgctcgcgcggagagacaatgaatattggattgaaaattgcagggccc
gatgagaacatatttcgagacagcgactgtgacgacccggtggcgccttgggaacccgaa
tcgctcccatcgacagataagctttaccttgatagggtttcatcttgcaatcctctcgaa
ggcctgctcgctcaacgagttggctgcatggaatgcggatggactgaagggctctcgctg
atacctttcaattgcctcactgttcctctaggcaaaagaccttcgtacgatgttcgcgaa
tgtttggaccaatacatggcacttgagcctattgaaggcgtggaatgcgctaagtgcacg
ctgttgcatcgacaggaccagcttatcaatctgattagtggatttgaagcggacgagagt
cggccagagagccccgatgagcctcagccactggatgctgtgaaactgtcagcccactcg
cggttagaggctgtcaagacagctttggacggcaatgattttagcgaaaacacattggca
aacaaatgccacatcaactcaaagaacagaacctccaccacgaaatctcgacaagcagtc
attgcgcgggctcctcgctgtctcgctatccatatcaaccgcagtgttttcgacgagtac
actgggacgttggagaagaatcttgcgacagtcacctttcctcaaatgattgatttgaac
aattggtgtcttggcacccagcctctcagcaaatctggcgacaattctgagcattgggag
acaaatccctctcggtccatgcttccgcaacctggtgaatcaattcaagtccctagcaga
cattatcaattacgcgcaataatcacccattacggccggcatgagaatggacactatatc
tgctatcgcaagtatccgacatcggaattcacagctcccgcaccagacgaaatccttcaa
gccgagggtgataaggacaagcccgagcggtggtggcgcctcagcgatgatgacgtgcag
atggttagtgaaggtcatgtgatgacccaaggaggtgctttcatgctgttttacgaagct
gtggatgattctgtctcaccgtgttcgactcgatctgcaactccagaacatgatctatac
gagaaatatgcaggatcttgtcagttcgaaagtgaggaatcgatgtgcaactcggccatg
ccaaaagacacttcccctccatctactgtcaccgacttcgaatctgccacttcccgtgag
accagtatctcgttgccgatggacgacttgcttcctgccgaccagcctttgaagacctca
aatacgattgacgccgatgctgaacggaatgctaaactggactcaccctctaccgtcgtt
gcatga

DBGET integrated database retrieval system