KEGG   Penicillium chrysogenum: Pc21g03400Help
Entry
Pc21g03400        CDS       T01091                                 

Definition
Pc21g03400
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pc21g03400
   01230 Biosynthesis of amino acids
    Pc21g03400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc21g03400
   00051 Fructose and mannose metabolism
    Pc21g03400
   00562 Inositol phosphate metabolism
    Pc21g03400
Enzymes [BR:pcs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pc21g03400
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pc21g03400
  Exosomal proteins of bladder cancer cells
   Pc21g03400
  Exosomal proteins of melanoma cells
   Pc21g03400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 249 aa AA seqDB search
MPRQFFVGGNFKMNGVAQSITDIVNNLNAAKLDDTTEVVISPPAIYLALTRELANPKIGV
AAQNVYDKPNGAFTGEISVEQLRDNKINWAVIGHSERRVILKESDEFIARKTKAAIEGGV
SVIFCIGETLEEREANKTIEVVTRQLNAVAKELSAEQWDKVVIAYEPVWAIGTGKVATTE
QAQEVHAAIRKWLGEAISAQAQENVRVIYGGSVSEKNCRELATQPDVDGFLVGGASLKPA
FVDIINARI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccaattcttcgtcggtggtaacttcaagatgaatggtgttgctcagagcatc
actgacatcgtgaacaacctcaatgccgccaagctcgacgacaccaccgaggtcgtcatc
tctccccccgccatctacctcgctctgacccgcgagcttgccaaccctaagatcggtgtt
gctgcccaaaacgtctacgacaagcccaacggtgctttcactggcgagatcagcgttgag
cagctccgcgataacaagattaactgggctgtcatcggccactccgagcgccgagtgatc
ctgaaggagtctgacgagttcattgctcgcaagaccaaggccgccatcgagggcggtgtc
tctgtcatcttctgtatcggagagaccctcgaggagcgtgaggccaacaagaccatcgag
gttgtcacccgccagcttaacgctgtcgccaaggagctgagcgcagagcagtgggacaag
gtcgtcattgcctacgagcccgtctgggctattggcaccggaaaggtcgccaccactgag
caggctcaggaggtccacgccgctatccgcaagtggctcggcgaggccatctccgcccag
gctcaggagaacgttcgcgtcatctacggtggctccgtcagcgagaagaactgccgtgag
ctcgctactcagcctgatgttgacggtttcttggttggcggtgccagcttgaagcctgcc
ttcgtcgacatcatcaacgcccgcatctaa

DBGET integrated database retrieval system