KEGG   Penicillium chrysogenum: Pc21g05160Help
Entry
Pc21g05160        CDS       T01091                                 

Definition
Pc21g05160
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pcs  Penicillium chrysogenum
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Pc21g05160
Enzymes [BR:pcs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Pc21g05160
Glycosyltransferases [BR:pcs01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Pc21g05160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 776 aa AA seqDB search
MSSPSPSLRKRGGKKDVYTALPSDDTSTPVSVPVKQKSEWDYWLAIVILTLLAFATRFYR
LDYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALMGWLVGFDGSFLFENIGDS
YIENNVPYLSLRAMPATLGALTIPVVFLIMWESGYSLPACVLSAGLMVFDNAHVGEDRLI
LLDATLVLSMALSILCYVRFYKLRHQPFGRKWWKWLLLTGFCMSCVISTKYVGFFTFVTI
GAAVLIDLWNLLDINREQGALSMISWGKHFIARAVGLVIIPFMFYLFWFQVHFAILNRSG
PGDDFMTPEFQETLSDNQMTAQSVGIQYFDTITMRHKDTKVFLHSHWDKYPLRYDDGRIS
SQGQQVTGYPHNDTNNQWQILPAEPLADSSEPKSVRNGDIIQLRHIGTESYLLTHDVASP
FFPTNQEFTTVSQELADGERHNDTLFELKIESGKTAQEFRTLASLFKLVHVPTRVALWTH
TTPLPEWGYKQAEINGNKNILQSSNMWYVENIENLAEDSPRLVKEERKVKTLPFLRKYFE
LQGAMFHHNNALTSSHPYATEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIGWWIASSIL
AVFAGVVGADQLSLRRGVDALEEIWGPGTRSRLYNSTGFLFLCWAAHYFPFWLMGRQRFL
HHYLPSHLASTMVCGALIEFIFNLQPLDPRTALPPVDDPSGKSKARSLSSLRRFITAKER
MGCRSLIAGWIATLIILAATIWGFIFYAPLTYGTPGLDVAGVNARKWLNYDLHFAK
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccccttcgccctctctgcggaagagaggcggaaagaaggatgtttacaccgca
ttgccctctgacgatacctcgacacccgtgtcggtgccggtcaaacagaagtcggaatgg
gactattggctggccatagtgattctcacccttctggctttcgcgacacggttctaccgc
ctcgattaccccaatgaggttgtattcgatgaggttcatttcggcaagttcgcttcttac
taccttcaacgtacctatttcttcgatgtgcacccgccttttggaaagctgttgtttgcc
ctcatgggttggctcgtgggcttcgatgggagcttcctgtttgagaacatcggcgactct
tacatcgaaaacaatgtgccctacctctccctccgtgccatgccggctactctcggtgcc
ttgacaattcccgtggtgttcctcatcatgtgggagtctggctactccctgccagcgtgt
gtgctgtctgccggtctgatggtgtttgataacgcacacgtgggtgaggaccgcctgatc
cttttggacgcgaccctcgttctgtcaatggcactcagtatcttgtgctacgtccgtttc
tacaagttgcgtcaccaaccgttcggccggaagtggtggaaatggcttctcctgaccggc
ttctgcatgagttgtgtcatctccaccaaatacgtcggtttcttcactttcgtgaccatc
ggcgcggcggtcctcattgacctgtggaacctcctggatatcaaccgcgagcagggagcg
ctaagcatgatcagctggggcaagcattttattgctcgcgctgttggattggtcatcatc
cccttcatgttctacttgttctggttccaggtccacttcgctattctcaaccggtctggc
cccggtgacgacttcatgacccctgagttccaggagactctgagtgacaaccagatgacc
gctcagtccgttggcattcaatacttcgacaccattaccatgcgccacaaggacactaag
gtcttcctccacagccactgggataagtaccccctgcgttatgacgatggccgtatttcc
agccagggccagcaggtcactggctatccccacaacgacaccaacaaccagtggcagatc
ctgccggccgaacctctggctgattcgtctgagcccaagagcgtgcgcaatggcgacatc
atccagctccgtcacattggaaccgagagttatctcctgactcacgatgttgcatctccc
ttcttccccaccaaccaggagttcactacagtctcccaggaattggctgatggtgagcgc
cacaatgacaccctgttcgagctcaagatcgagtcgggcaagactgcccaggagttccgt
actcttgctagcttgttcaagctggtccacgtcccaaccagggtcgctttgtggacacac
acaacccctctgcccgagtggggttacaagcaggctgaaattaacggtaacaagaatatc
ctccagtccagcaacatgtggtacgttgagaacatcgagaacttggcggaggatagtcct
cgcctggtcaaggaggagcgtaaggtcaagaccctgcctttcctgcgcaagtacttcgag
ctgcagggtgccatgttccaccacaacaacgctctcaccagcagccacccctatgccacc
gagcccttccagtggcctttcctgttgcggggtgtgagcttctggactaagaacgatact
cgtgagcagatctactttttgggtaaccctattggatggtggattgccagtagtattctg
gccgtgtttgccggcgttgttggtgctgatcagctttcgcttcgccgtggtgttgatgcg
ttggaagaaatttggggccccggtacgcgttcgcgtctgtacaacagcaccggtttcttg
ttcctgtgctgggctgcgcactacttccccttctggctgatgggtcgccagcgcttcctg
catcactacctgccctcgcacctggcgtccaccatggtgtgtggtgcactgattgaattc
attttcaacctgcagccgctcgatccccgcactgcacttccccctgtggatgatccctcg
ggcaagtctaaggcgcggtctctcagcagtctgcgccggttcatcacagccaaggaacgc
atgggctgcaggtcgctcatcgcaggctggattgccacacttatcattctagctgcaacc
atctggggcttcattttctatgcgcccttgacttatggtacccccggcctcgatgtggcg
ggcgtcaatgcgcgcaagtggctgaactacgacctgcactttgccaaataa

DBGET integrated database retrieval system