KEGG   Penicillium chrysogenum: Pc21g06570Help
Entry
Pc21g06570        CDS       T01091                                 

Definition
Pc21g06570
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pc21g06570
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pc21g06570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 375 aa AA seqDB search
MRFATSTLTLLLQGAIALDVGPDYSHPIEDLDVDLPFSQPVTFAHLEWQRCLAESHNKPL
DIAVLGFPYDTSTSYRPGARFGPRGIRAGSAREKKGRSYNTVWEVDPYDEGLEIIDCGDI
PITPFDAAHAFKQMEQGYRQVLYHPTSEGNSWEHPRIVSLGGDHSIVLPILRSLKHVYGP
ISVIHLDSHLDTWDPYEGYTGIASNQSAITHGTFFWHASREGCISKGTSVHGGLRTKLFS
PKDYEIDQNVGFTIIEAHEIDDIGMSGIIGKVRNVVKDTPTYLSIDIDVLDPSIAPATGT
PESGGWTTRELKRFIKGLEGVNLVGADVVEVSPPYDSVAETTSIAAADLIVDILASMAKL
KTGPKAKTATSKDEL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgcaacttctacattaacccttctgttgcagggcgccattgctttggacgtt
ggtccagactatagtcatcctatagaagatctcgacgtcgatcttccattttctcagccg
gtcacattcgcccacttggaatggcaaaggtgtctggcagaatctcataataaacccctc
gacatcgccgttcttggcttcccatacgacacctcgacatcataccgccccggcgcaaga
ttcggtcctcgaggcatccgcgccggatcagcgcgcgaaaagaaaggacgaagctacaac
accgtgtgggaggtggacccatatgacgagggacttgaaatcatcgactgcggagatatt
ccgattaccccattcgatgccgcgcacgcattcaagcaaatggaacagggttacagacag
gttctctaccacccgacgtccgaggggaactcgtgggagcatccgcggattgtgagtctc
ggtggcgatcactcgattgtcttgcctatcttgcgatcattgaaacatgtgtatgggccc
atctctgttattcacctggactcgcatctcgacacttgggatccgtatgagggttatact
gggatcgcttctaaccagtcggcaattacgcatgggactttcttctggcatgcgagtcgg
gagggatgtatttccaaggggacgagtgtccatggagggttaaggacgaagctttttagt
cctaaggactacgagattgaccagaacgttggatttacgattatcgaggctcacgagatt
gacgatattggcatgtctgggatcattggtaaggtccggaatgttgtcaaagatactcct
acctatctttccattgatattgatgtcctcgatccgagcatagcccctgcgactggaaca
cccgaatctggcggctggaccactcgtgagttgaagcggtttatcaaaggcctcgagggg
gtgaatcttgttggtgccgatgtagtggaagtcagcccgccatatgacagtgttgctgag
actacttcgatcgctgctgcggatttgatcgttgatatactcgcatccatggcgaagttg
aagacaggacccaaggcgaagacggcaacttcgaaagatgaattgtaa

DBGET integrated database retrieval system