KEGG   Penicillium chrysogenum: Pc21g07230Help
Entry
Pc21g07230        CDS       T01091                                 

Definition
Pc21g07230
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pcs  Penicillium chrysogenum
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pcs00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 505 aa AA seqDB search
MGFFDHLQKGGAGAFSLQPKKAQIRKVVQTRPAAPTRSVTQPSETRSPRVPSSTERNRKA
QTLKSRSVSSDLEARSAKRLSTPSRIRKRPTPEQRLSSDDDASDSEASFEVHKRARTSAS
AEPDPERRLRSVKAFSEEGSRPFKMIHAADISSGPKAGKFKPAFGAEGKPKEILLQYPSA
SQRERYDSVVPRENDEFRPIDDIVQVIETVSENYIPSEEADQFNNETTGIKRRLRRALAV
TSETQFREAVDDYNKAIQRLRSNGSLAKHLDATQRIGLPWVERILTQIYSRTVSPQVESL
RQYENGTDNVYGELLPRFISTIFKETKLKSGQVFVDLGSGVGNVVLQAALEVGCESWGCE
MMSNACDLADLQQSEFKARCRLWGIAPGKTHLVRGDFLEQESITNVLKRADVVLINNQAF
TPQLNNELINHFLDMKEGCKIVSLKSFVPAGHKIQSRNLNSPINLLKVQQKNYWSNNVSW
TDVGGTYFIATKDSSRLRAFIDNMS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttcgaccaccttcaaaaaggaggggccggggccttctctctacagccaaag
aaggcgcaaattcgcaaggttgtgcagactcgacctgcagctcctacacgatcggtcaca
caaccctcggagactcggtcacctcgagtcccgtcctcgacggagcggaaccggaaggcg
cagacgttgaaatctcgatcggtgtccagtgacctggaagcacgctcggcaaaacgactg
agtactccgtcgcgcattcgaaaaaggccgacacccgaacaacgactctcgagcgatgat
gacgcgagcgatagtgaggcctcctttgaagttcacaaacgcgcgaggaccagcgccagc
gctgaacccgacccggagcggcgtctccgctcggtgaaggccttttcggaagaaggatct
cgcccgtttaaaatgatacatgccgcggatatatcgtccggtccgaaggccggcaagttc
aagcccgccttcggtgccgagggcaagcccaaagagattctcctgcaatatcccagtgcc
tcgcaacgggagagatatgactccgtggttccccgcgaaaatgacgaattccgacctatt
gacgacattgttcaggtaatcgaaacagtctccgagaattacatacctagtgaggaggcg
gatcaattcaacaatgagacgaccgggatcaagcgccgattacgccgggccctggctgtg
acatccgagacccaatttcgggaagctgtcgacgattacaataaagctatccagcggtta
aggagcaacggaagtcttgcgaagcatttggatgcgacacagcgtattggtttaccttgg
gtggaaagaatcctcactcaaatttactcgcgcacggtatcccctcaagtggagtccctc
cggcaatacgagaatggcacggacaacgtttacggagaacttctccctcgctttatcagc
acaatcttcaaagaaaccaagctcaaatcgggacaggtctttgtcgatcttggctcggga
gtaggtaatgtcgttcttcaggcggcgctcgaggttggctgtgagagttggggttgcgag
atgatgtcaaacgcatgtgatttggcagatttgcagcaatccgagttcaaggcccgatgc
cggctgtgggggattgccccaggcaaaactcatcttgtccgaggcgactttcttgagcag
gagagtatcaccaatgtcttgaagcgggctgatgtggtgctcatcaacaaccaggctttc
accccgcaactgaacaatgagctgatcaaccactttttggatatgaaagaaggctgcaaa
attgtctcactcaagtcttttgttccagctggccacaaaatccaatctcgcaacctgaac
tctccgatcaatctcctcaaggtccagcagaagaattactggtcgaacaacgtgagctgg
accgacgttggcggtacatatttcattgccactaaagacagctctcgcctgagagccttc
attgataatatgtcatag

DBGET integrated database retrieval system