KEGG   Penicillium chrysogenum: Pc21g07230Help
Entry
Pc21g07230        CDS       T01091                                 

Definition
Pc21g07230
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pcs  Penicillium chrysogenum
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Pc21g07230
Enzymes [BR:pcs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Pc21g07230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 505 aa AA seqDB search
MGFFDHLQKGGAGAFSLQPKKAQIRKVVQTRPAAPTRSVTQPSETRSPRVPSSTERNRKA
QTLKSRSVSSDLEARSAKRLSTPSRIRKRPTPEQRLSSDDDASDSEASFEVHKRARTSAS
AEPDPERRLRSVKAFSEEGSRPFKMIHAADISSGPKAGKFKPAFGAEGKPKEILLQYPSA
SQRERYDSVVPRENDEFRPIDDIVQVIETVSENYIPSEEADQFNNETTGIKRRLRRALAV
TSETQFREAVDDYNKAIQRLRSNGSLAKHLDATQRIGLPWVERILTQIYSRTVSPQVESL
RQYENGTDNVYGELLPRFISTIFKETKLKSGQVFVDLGSGVGNVVLQAALEVGCESWGCE
MMSNACDLADLQQSEFKARCRLWGIAPGKTHLVRGDFLEQESITNVLKRADVVLINNQAF
TPQLNNELINHFLDMKEGCKIVSLKSFVPAGHKIQSRNLNSPINLLKVQQKNYWSNNVSW
TDVGGTYFIATKDSSRLRAFIDNMS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttcgaccaccttcaaaaaggaggggccggggccttctctctacagccaaag
aaggcgcaaattcgcaaggttgtgcagactcgacctgcagctcctacacgatcggtcaca
caaccctcggagactcggtcacctcgagtcccgtcctcgacggagcggaaccggaaggcg
cagacgttgaaatctcgatcggtgtccagtgacctggaagcacgctcggcaaaacgactg
agtactccgtcgcgcattcgaaaaaggccgacacccgaacaacgactctcgagcgatgat
gacgcgagcgatagtgaggcctcctttgaagttcacaaacgcgcgaggaccagcgccagc
gctgaacccgacccggagcggcgtctccgctcggtgaaggccttttcggaagaaggatct
cgcccgtttaaaatgatacatgccgcggatatatcgtccggtccgaaggccggcaagttc
aagcccgccttcggtgccgagggcaagcccaaagagattctcctgcaatatcccagtgcc
tcgcaacgggagagatatgactccgtggttccccgcgaaaatgacgaattccgacctatt
gacgacattgttcaggtaatcgaaacagtctccgagaattacatacctagtgaggaggcg
gatcaattcaacaatgagacgaccgggatcaagcgccgattacgccgggccctggctgtg
acatccgagacccaatttcgggaagctgtcgacgattacaataaagctatccagcggtta
aggagcaacggaagtcttgcgaagcatttggatgcgacacagcgtattggtttaccttgg
gtggaaagaatcctcactcaaatttactcgcgcacggtatcccctcaagtggagtccctc
cggcaatacgagaatggcacggacaacgtttacggagaacttctccctcgctttatcagc
acaatcttcaaagaaaccaagctcaaatcgggacaggtctttgtcgatcttggctcggga
gtaggtaatgtcgttcttcaggcggcgctcgaggttggctgtgagagttggggttgcgag
atgatgtcaaacgcatgtgatttggcagatttgcagcaatccgagttcaaggcccgatgc
cggctgtgggggattgccccaggcaaaactcatcttgtccgaggcgactttcttgagcag
gagagtatcaccaatgtcttgaagcgggctgatgtggtgctcatcaacaaccaggctttc
accccgcaactgaacaatgagctgatcaaccactttttggatatgaaagaaggctgcaaa
attgtctcactcaagtcttttgttccagctggccacaaaatccaatctcgcaacctgaac
tctccgatcaatctcctcaaggtccagcagaagaattactggtcgaacaacgtgagctgg
accgacgttggcggtacatatttcattgccactaaagacagctctcgcctgagagccttc
attgataatatgtcatag

DBGET integrated database retrieval system