KEGG   Penicillium rubens: Pc21g08400Help
Entry
Pc21g08400        CDS       T01091                                 

Definition
(RefSeq) Pc21g08400
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pcs  Penicillium rubens
Pathway
pcs00280  Valine, leucine and isoleucine degradation
pcs00410  beta-Alanine metabolism
pcs00640  Propanoate metabolism
pcs01100  Metabolic pathways
pcs01200  Carbon metabolism
Module
pcs_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pc21g08400
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pc21g08400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pc21g08400
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Pc21g08400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 8317233
NCBI-ProteinID: XP_002567879
UniProt: B6HLY2
Position
1
AA seq 473 aa AA seqDB search
MPLRAKVTNPAFRATAMMSTTPDIPKELPGDERDDVLFNSIYGLRSVELNRPKKLNSLNG
SMARKILPRLKEWEKSHLANMILISGAGTKALCAGGDVAALALQNESGVEGQKASTDFFG
LEYRLDHLIATYSKPVISFMDGITMGGGVGLSMHAPFRIATERTVFAMPETTIGFFPDVG
GSFFLPRLDGETGTYLALTSERLQGVQALYAGIATHYLHSSVLSNVAQRLSELTFPDHVE
LPERLEIVNKTMAEFSLGLPSLEEEPMLMAGGLRTAIDRCFRFNTMEEIIQALEEETEHK
EWAQKTLETLSGRSPTSLKVTLRQLRLGKKWSISETFQREHKIAGNFMRHPDFVEGVKAR
LMSKPARKPEWQPATLGEVSDKTVDKFFKISEGESRLPLLSQGDYKNYPHAHFALPSEEE
IEKVVRQGHSSRRPVVDYFLQKYAHREGVRRKVVEVIARRTTTSSPEGLKWVD
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcctctacgagccaaggtgaccaaccctgcctttcgggcaacagctatgatgtcgact
acacctgatatccccaaagagctccccggtgatgagcgcgatgatgttctgttcaactca
atctacggcctgcgcagcgttgagctcaaccgacccaagaagctcaactccctcaatggc
tcgatggctcgcaagattctccctcggctgaaggagtgggagaaatcccatcttgcgaac
atgatcctcatctccggagccggcaccaaggctctctgcgcaggaggtgatgttgctgcc
ctcgcgttgcagaatgagagtggagtggaaggacaaaaagcatcgacagatttcttcggc
ctggaataccgcctcgaccacctgatcgccacatactcgaagcctgttatctcatttatg
gatggaatcaccatgggcggtggtgtgggcctcagcatgcacgcccccttccgaattgcg
actgagcgtaccgtttttgctatgcccgagaccactattggcttcttcccggacgttggc
ggctcgttcttcctcccgcgcctggatggtgagactggtacatacctggctctgacctcg
gagcgcctgcagggtgtgcaggctctgtatgcaggcattgccacacactacttgcactcc
agtgttctgagcaatgtggcgcagcgtctttctgagctgactttccccgaccacgtcgag
cttcccgagcgtttggaaatcgtgaacaagaccatggctgagttctcccttggtctcccc
tcgcttgaggaggagcctatgctcatggccggtggcctgcgcactgccattgaccgctgt
ttcagattcaacaccatggaggagatcatccaggctttggaagaggaaactgagcacaag
gagtgggcacaaaagacattggagactttgtcaggccgctccccaacttctctgaaggtg
accctgcgccagctgcgtcttggtaagaagtggagcatctcagagaccttccagcgcgag
cacaagatcgctggcaacttcatgcgccaccctgatttcgttgagggtgtcaaggcccgc
ctgatgtccaagcctgcccgcaagcctgagtggcagcccgctactctcggtgaggtctcg
gataaaaccgtggacaagttcttcaagatctctgagggcgagtcccgcctaccacttctg
agccagggagattacaaaaactaccctcatgcccactttgctcttccctctgaggaggag
attgagaaggttgtgcgccaaggccactcatcgcggagacccgtggtcgactacttcctc
cagaaatacgcccaccgcgagggtgtgcgccgaaaggtcgttgaggtgattgcccgacgg
acgaccacatcatctcccgaaggactcaagtgggtggattaa

DBGET integrated database retrieval system