KEGG   Penicillium chrysogenum: Pc21g09050Help
Entry
Pc21g09050        CDS       T01091                                 

Definition
Pc21g09050
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pcs  Penicillium chrysogenum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Pc21g09050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1673 aa AA seqDB search
MAELQDTRNGLRGLYQDLSALSNSQLPNVDRLCFELETHIQDFRKLLDKPAKNNASRQAV
LSATNVKCDTGKITVADVEYSVNQDFQQGALQLADALDIDELEAAVMFLAAQENSQALDR
PPLIAAIISFHERRLFTLECLRLIFRESREIEHETTHPIMHETLAHVLEIKNSPLRNASL
FARKALSSMADIQKWLSLLGDQVQKASVVGQENDRDIMEAIEFQRTSLQQQHESLGAILF
YMFKGTYTSSEDFRILVGQLKNIDCFDGLLFHYIPVTIASFVQHGSPEGSGSEKEARDLH
KLITATKDGQGWKLSNFHAALVALWLSVYSGWYFDGLSSPSVDAEKESEERTKMFMSSLD
DGALDFMLAICSSVNTEEWADPARSELVSLLLRESVVSLPDPEPCSGFMKELLMENFEVF
VESCVANMPDAVRRLKSEEDSQRLDQITALRDGLTSNLHRGLVEVRTHLESLLMIISFAF
EHRQEAAQEFWADPDGNLYGFLQWASKRQTVPRVSAFCEMLCSISEGEENAGAAHRFLSE
EDKFMSTKFKRSTTMNWSQMFAELKLYASRVTEKPSTTTSPQGAPGIFRPRKPEPVEMNE
PESPVMLTCYLRLIGHLCKQSQPIREWMLQNESFNVVSTLLDLCSGPIPSHLRATTFSTL
SALMTDKFSAVGKETWARLDGWLSGGTGASGIGKVPLVSNPAVWHQQQALQKIGESFDQT
NAFIVLINALIAPSPDSIDDPMSLPFPETLGGTYRMSGIEPYIDFILGHAFSRKIQDLNE
YQSRLLTFSCLDFVVASLKSFNEDLVLLLSQPSVSDSPTQTSSLLTYVRSHPFARVVDWL
FNEDVLKSLFATSKQNVSDVAAASPDSVLVLTLHRSLEVMNLLVDLQSTYFNIVKPLVQT
QPGPSRTIVANSSLASFEDTVLNNLTLIPSLCLYCGTAHEQLTVISMALLEKLTSSRKLN
KMTSPELVKWQSSNKIVEVLASEVDVDSISRPLVLQMEPDVRELDYGPNAAGYVIRESLL
ALLNSCLGAITDRPTVAHLLLGFDCVGNILDVSAEGLFANQSSLLHAIVNFLKAYPEILD
GGIISWVVHLKRMAFEVLKHLWSSKLASYYTLGEMRAQAFLREMFAYQPIIGPSTTWNGF
PIDSDEFWLTDAATALAEFLLYRSHLFTYAATEVRSTAKARSPALHTQILSVLLGNTVSD
DGEPISSPSVFDLFDFADLDVGRQFNMPQLHLLGDVALQLESKREEGVYSMEGVEEMIQM
RKAELTANGPLRPHDEEQLLIEANDLKLFILAMKQNNLIQTNRYHALRSWVELVATMITC
SAMDEGSKPAFILHSIQLILPKLTTAIEADLPEALELARLAELLIGRLASEPSATDVSRS
GDVIDEKLHQLFQLCIRGTNLATGNVLLRETLYSICSHYITRITSSSKGHENLRRLSQHV
IKAAGSSLIETMCDDAYTGQESCRASALVLLNSLAVLDRQTDCVLAELISRSNYLSLFLD
ALRSLPLELHNAQGSDTPALLAYYESLLSLLQRLSQTKGGANCVLNSGLFQAVHESRLFA
ADPDIGIDIENPDALQRYYDLILSVLQVIVYAVFSRGIHNEQLKEQTRVFLAENRPCMVG
IFKRSAKIGNTSSAHHETLCELVKTFMALVTATDFMEFEEQEVQHIARPALFS
NT seq 5022 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctccaagatacccggaatggcctccgtggcctgtatcaggatctctctgcc
ctttcgaacagtcaactccccaacgtcgatcgcttgtgtttcgaattggagacccatatt
caagacttccgcaaactcctagacaagccagcgaagaacaatgccagccgtcaagctgtt
ctctcagctactaatgtcaaatgcgatacagggaagatcaccgttgccgacgttgaatac
tcggtgaaccaggatttccagcaaggcgcactgcaacttgcggatgcgctcgacatcgat
gaattggaagcagcagttatgtttttggccgcccaggaaaattcgcaagcgctggacagg
cctccactgatcgctgcgataataagcttccacgagcgccgcctttttaccctcgagtgc
ctacgtctcatcttccgagaatcgcgtgaaattgaacatgaaacgacccaccctatcatg
cacgaaacgctagcccacgtcctggaaattaaaaacagccctctgcggaatgcctccctc
ttcgcgcgaaaagccttgagttccatggccgacatccaaaaatggctgtcccttcttgga
gatcaagttcaaaaagcttcagttgtcggccaggaaaatgaccgcgatatcatggaagcc
attgaattccaacgtacgagtctgcaacagcagcatgagtcacttggagcgatcctattc
tatatgttcaaagggacatacaccagcagcgaagacttccgcatacttgtgggtcagttg
aagaacattgattgcttcgacggacttttgtttcactacattccagtcacaattgcgtct
tttgtacagcatggttctcccgagggctctggatccgagaaggaggcacgagacctgcac
aaattaattaccgcaaccaaggatggccaaggatggaagctgtcaaatttccacgccgcc
cttgttgctctgtggctctcagtctacagtggatggtactttgatggtctttcatcccca
tcagtcgacgcagagaaggaatctgaagagcgtacgaagatgttcatgtcttctctcgac
gatggtgcccttgatttcatgcttgcgatctgctccagcgtcaacaccgaggaatgggca
gaccccgcgcggagcgaattagtctcattactgctcagggaaagtgtcgtatcattgcct
gatcccgagccatgctctggctttatgaaggagcttttgatggaaaacttcgaggttttt
gtggaatcgtgcgttgcaaatatgcctgacgctgtccgacggttgaagtcggaggaggac
tcacagcgactggaccagatcaccgcactccgagacggccttacttctaacctccaccgt
ggcttggtagaggtgcggactcaccttgagtccctccttatgatcatctcattcgcattt
gagcaccgacaggaagccgcccaagaattctgggctgaccctgatgggaatctttatggc
ttccttcagtgggcatccaagcgacagactgttcctcgggtcagcgctttttgcgaaatg
ctgtgttcgatatccgagggcgaagaaaatgcaggtgcggcgcatcgattcctgtcggag
gaagacaagtttatgtctaccaagttcaagcgatctacaacaatgaattggtcgcaaatg
ttcgctgaactaaagctttacgcatctcgtgtcactgagaagccttccacaactacaagc
ccccaaggagcgccagggatctttcgtccacggaaaccagagcccgtggaaatgaacgag
cctgagagcccagtgatgctgacatgctaccttcggctgataggccacctgtgcaagcag
agtcaacctatccgagagtggatgctgcaaaacgagtcgttcaatgttgttagcacactg
ttagacctgtgcagtggcccgattccatcgcatcttcgggcaactaccttttcaactctc
tcagcattaatgactgataaattctccgccgttggaaaggaaacgtgggcccgtctcgat
gggtggttatcgggaggaactggtgcgtccggaattggcaaagtccctttggtttccaac
cctgccgtctggcaccagcaacaagccttgcaaaagattggagagagctttgaccagaca
aatgcattcattgttcttatcaatgcacttattgctccctcacccgactcaattgacgac
ccgatgtcgctgcctttcccggagaccctaggtggaacttatcgcatgtccgggatcgaa
ccttacatcgatttcatcctgggacatgccttttcacggaagatacaagatcttaacgag
taccagtcccgcctgttgaccttcagctgcctggacttcgttgtggcaagcttgaaatcc
ttcaatgaagacctggtgttacttctgagccagccgtccgtgtccgattccccgacacag
acttcatcgctgctcacttacgttcgctcccatccttttgcccgcgtggtggactggctt
ttcaacgaagacgtactcaaatctctgtttgcaacctcgaaacaaaacgtttctgacgtg
gctgccgcgtcgcctgactctgttctggttctaaccttgcaccggagtctggaggttatg
aacttgctcgtggacctgcagtcaacatactttaacatcgtcaagcctttggtacaaacc
cagcccggaccatcccggaccatcgtggcaaactcctcgctcgcttcgttcgaggacact
gtgctgaacaatctgacactcatcccctcactctgtctctattgtggcacggcgcatgag
caactcactgtcatttccatggctctactggaaaagcttactagttccagaaagctcaac
aagatgacctcaccggagctcgtcaagtggcaatcctcgaacaagattgtggaggtgctt
gcatctgaggtcgacgtggacagcatatcccggcctcttgtgttacaaatggaacctgat
gtgagagaacttgattacggcccgaatgctgccggctacgtcattcgggaaagccttctt
gctcttttgaacagttgcctgggagcgatcacagaccgcccaacggttgcccatctgctg
ctgggattcgactgcgtgggcaatattctcgatgtgtcagcggaagggctattcgcgaat
caaagttccttgctgcatgccatcgtgaatttcctgaaggcttatccggagatcctcgat
ggtggcattatatcttgggtagtgcacctcaaacgtatggcctttgaagtgctgaagcat
ttgtggtcatcgaagctggcaagctactacacccttggtgaaatgcgtgctcaggcattc
ctgcgcgagatgtttgcctaccaaccgattattggcccaagcactacctggaatggattc
cctattgattcagatgaattttggctcacagacgctgctactgcactggctgaattcctg
ctttaccgaagtcacctcttcacatatgctgcaaccgaggttcgctcgacagcaaaagct
agatcaccggctctacatacccaaattctttccgtattgctcggaaacacggtttcggat
gacggtgaaccgatatccagtccgtccgtgtttgaccttttcgatttcgcagatcttgat
gttggacgccagttcaacatgccccagctccacttgcttggtgatgttgctcttcaatta
gaaagcaagcgggaggagggcgtgtacagcatggaaggggtagaagagatgatacaaatg
cggaaagcagaactcacggccaatggaccgctccgcccgcacgatgaggagcagctgcta
attgaggcgaacgatctcaagttgttcattctcgcaatgaagcagaacaatctgatacaa
acaaatcgctatcacgccctccgttcctgggtagagctcgttgccaccatgatcacttgt
tctgctatggatgaaggaagcaagccagctttcattctacattcaatccaattgattctc
cctaagctcacgacggcgatcgaggcggatctccccgaagcgcttgaactggcacgattg
gccgaattgttgatcggtcgacttgcatcggagccatcggcgacagatgtgtctcgaagc
ggagatgtaatcgacgaaaagctccaccagctcttccaactctgcatccgaggcaccaac
ctagcaacagggaatgtgttgttgagagaaacactttacagcatttgttcccactacata
acacgcatcacatcgtcgagcaaaggccatgaaaacctacggcgccttagccaacatgtc
atcaaagcggccggttctagcctgattgagaccatgtgcgacgacgcctatactggccaa
gagtcgtgccgtgcatctgcccttgtgctattgaacagtttagctgttttagatcgccaa
actgattgtgtgttggctgagttaatctcgaggtccaattatttgagcctattcctggat
gccttgcggtctcttccccttgaacttcacaatgctcaggggagcgacaccccggcacta
ctggcatactacgagtcgcttttgtcgttacttcagcggctctctcaaaccaagggcgga
gcaaattgtgtgctcaactctggtctcttccaagccgtgcacgaatcacgacttttcgct
gctgatccagacatcggcattgacattgaaaatcccgatgcgcttcagagatattacgac
cttatcctttcagtccttcaggtcatcgtgtatgcggttttctctcgaggtatccacaac
gaacagcttaaggagcagacccgcgtattcttggctgaaaaccggccatgtatggtgggt
atcttcaaacgatctgccaagattgggaacacatcaagcgcccaccacgagactctttgt
gaactggtcaagacattcatggctcttgttactgccacggatttcatggagttcgaggag
caggaagttcaacatatcgcccgaccagcattgttctcatga

DBGET integrated database retrieval system