KEGG   Penicillium chrysogenum: Pc21g10060Help
Entry
Pc21g10060        CDS       T01091                                 

Definition
Pc21g10060
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc21g10060
Enzymes [BR:pcs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pc21g10060
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pc21g10060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 684 aa AA seqDB search
MSSTIETSNIPTDGTGVIQLDPWLEPHRAVLKHRYQVVEEWAKTINETEGGLDKFSKGYE
TFGLHAQPNGEIKYQEWAPNAKEASLVGEFNNWDVNANPMTKNSFGVWNVTVPAKNGVAA
IPHDSKIKITMVLPSGERIYRIPAWIKRVVQDLTVSPAYDAVFWNPPVDEVHKFQHARPK
KPESLRIYEAHVGISSPETKVATYKEFTKNMLPRIKYLGYNAIQLMAIMEHAYYASFGYQ
VNNFFAASSRYGSPEDLKELVDTAHGMGLIVLLDVVHSHASKNVIDGINEFDGTDHLYFH
GGAKGRHELWDSRLFNYGNHEVLRFLLSNLRFWMEEYKFDGYRFDGVTSMLYTHHGIGTG
FSGGYHEYFGPAVDEEGVTYLTLANQMLHELYPDCITVAEDVSGMPALCLPHALGGAGFD
YRLAMAIPDMWIKLLKESTDDEWDMGSISFTLTNRRHGEKTIAYAESHDQALVGDKTLMM
WLCDKEMYTHMSTLTEFTPVIERGMALHKMIRLVTHALGGEGYLNFEGNEFGHPEWLDFP
RAGNNNSFWYARRQLNLTEDSLLRYRFLNEFDRGMQLTEQKYGWLSAPQAYISLKNESDK
VLVFERAGLLWIFNFNSTKSFTDYRVGVDAPGTYRIVLDTDETVFGGLGRNVKETRFFTT
DLEWNGRKNFVQVYIPTRTALVCA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaccattgaaacctcaaatattcccactgatggcactggtgttatccagcta
gacccttggctggaaccccatcgcgctgtcttgaaacatagataccaagtagtcgaggaa
tgggccaagaccatcaatgaaacagaaggtggactggacaagttcagcaagggctatgaa
accttcggacttcatgcgcaacccaacggagagatcaaataccaagaatgggcccccaac
gcaaaggaggcttctttagtcggcgaattcaacaactgggacgtcaatgccaaccccatg
acgaagaacagcttcggcgtctggaatgtaacggtaccggcgaagaacggcgttgccgct
attccccatgacagcaagatcaagatcacaatggtactccccagcggcgagcgcatctac
cgaatccccgcttggatcaagcgcgtggtccaagacctgaccgtgtctcctgcatatgat
gccgttttctggaacccgcccgtagacgaggtacacaagttccagcacgcgcggcccaag
aagcccgagagcctgcgcatctacgaggcacacgtcggcatctcgtcgccggagacaaag
gtcgctacatacaaggagtttacgaagaacatgctgccccgtattaagtatctgggatac
aatgcaatccagctaatggccatcatggagcatgcatactatgctagcttcgggtaccag
gtcaacaacttcttcgcggcgagcagtcgctacggatccccagaggatctgaaggagctt
gttgacacagcccacggcatggggctgatcgttctgcttgatgtggtccacagccatgcc
tctaagaacgtcatcgatggaattaacgagttcgatggaacggaccacctctacttccat
ggtggtgcgaagggccgtcatgagctgtgggacagccgtctgttcaattatggaaatcac
gaggtgctgcgtttccttttgagtaatctgcgcttctggatggaagagtataaattcgat
ggataccgcttcgatggtgtgaccagcatgctctatacccaccatggtatcggaactggc
ttctccggcgggtaccacgagtacttcgggccagccgtcgacgaggagggcgtcacatac
ctcaccctcgccaaccagatgctgcacgaactctacccagactgcatcacagtcgcagag
gatgtctccggcatgcccgcactgtgtctaccccacgcgctaggcggtgccggcttcgac
taccgcctcgcaatggccatcccagacatgtggatcaagctcctgaaggaaagcaccgac
gacgagtgggacatgggcagcatctccttcacgctcaccaaccgtcgccacggcgagaaa
accattgcctacgccgaaagccacgaccaagccctcgtcggcgacaagacactaatgatg
tggctctgcgacaaagagatgtacacacacatgtccacgctaacggagttcaccccggta
atcgagcgcggcatggcactgcacaagatgatccgactagtaacgcacgccctcggcggc
gaaggctacctaaacttcgaaggcaacgaattcggacacccagaatggctggacttcccc
cgcgccggtaacaacaattccttctggtacgcgcgccggcagctaaacctaaccgaagac
tcgctgctgcggtaccgtttcctgaacgagttcgaccgcgggatgcagctgaccgagcag
aagtatgggtggctttctgcgccgcaggcgtatatcagtttgaagaatgagagtgacaag
gtccttgtctttgagcgggccgggttgctttggatcttcaatttcaattctacgaagagc
ttcactgattaccgtgtgggcgttgatgcccctggtacgtatcggattgttcttgatacg
gatgagacggtgtttggtgggcttgggcggaatgttaaagagacgcgcttctttactact
gatctggagtggaatgggaggaagaatttcgtgcaggtttatatccctaccaggactgct
ttggtatgtgcttag

DBGET integrated database retrieval system