KEGG   Penicillium chrysogenum: Pc21g11280Help
Entry
Pc21g11280        CDS       T01091                                 

Definition
Pc21g11280
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Pc21g11280
Enzymes [BR:pcs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pc21g11280
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Pc21g11280
  Exosomal proteins of colorectal cancer cells
   Pc21g11280
  Exosomal proteins of bladder cancer cells
   Pc21g11280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 515 aa AA seqDB search
MRSFAPLVLSLLGATAAVHAAEPEVADADANVVTLTTDTFNDFIKEHPLVLAEFYAPWCG
HCKALAPKYEEAATELKAKDIPVVKVDCTEEEELCRTYEVDGYPTLKVFRGPDSHKPYAG
ARKADAIVSYMTKQSMPAVSNVNEENLEEFKALDKIVIIGYVASDDKAANKSFTSFAESQ
RDNFLFAASNDAALAKAEGAKQPSIVLYKDFDEKKAVYDGKLDEEAILEWVKTASTPLVG
ELGPETYSKYMAAGIPLAYIFAETAEEREQFAADFRPIAESHRGAINIVTLDAKLFGAHA
GNLNLEPEKFPAFAIQDTTKNAKYPYDQTKKVDAKDIGKFIKDVLDGKVEPSLKSEPIPE
TQEGPVTVVVGRNYQEVVIDNEKDVLVEFYAPWCGHCKSLAPKYEELAALFADVPELNEK
VTVAKVDATANDVPDSITGFPTIKLYPAGAKDSPIEYAGSRTVEDLVTFIKENGKYQVDG
LADGAKTPEERAEVTAAPKATESPASEEKDSHDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcggtctttcgcccctctggtccttagcctccttggagctactgcggccgttcacgct
gctgaacctgaagttgccgacgctgacgccaatgtcgtcactttgacaactgataccttc
aacgacttcatcaaggaacaccctttggtccttgctgagttctacgcgccttggtgtggt
cactgcaaagcccttgcccccaagtatgaagaggctgccacagagctgaaggccaaagat
atccctgtggtcaaggtggattgcactgaggaggaggagctgtgccgaacctacgaggtt
gatggctaccctactctgaaggtcttccgtggacccgattcacacaagccctacgctggt
gcccgaaaggccgacgcgattgtctcatacatgaccaagcagtcaatgcccgccgtctcg
aacgtgaacgaagagaacttggaggagttcaaggccttggacaagatcgtgattatcgga
tacgtggcttcggatgacaaggccgccaacaagagcttcacttcgttcgctgaatcccag
cgtgacaacttcctcttcgctgcctccaacgatgctgctctcgccaaggctgagggtgcc
aagcagccctcgattgttctctacaaggacttcgatgagaagaaggccgtgtacgacggt
aagctggacgaggaggccatcctcgaatgggtcaagaccgctagcacccctcttgttggc
gagcttggtcccgagacttactccaagtatatggcggctggtattcccctggcttacatc
tttgccgagactgccgaggagcgtgagcagttcgctgctgacttccgtcccatcgctgag
agccaccgtggagccatcaacattgttacccttgacgctaagctcttcggcgctcacgct
ggcaacctcaaccttgagcccgagaagttccctgctttcgccatccaggacaccaccaag
aacgccaagtacccttacgaccagaccaagaaggttgatgccaaggacatcggcaagttc
atcaaggacgtccttgacggcaaggttgagcctagcttgaagtccgagcccatccccgag
actcaggagggacctgttaccgttgttgttggtcgcaactaccaggaggttgtcattgat
aacgagaaggatgtcctggtcgagttctacgctccctggtgcggacactgcaagtctctt
gctcccaagtacgaggagcttgctgctctgttcgccgatgtcccggagctgaatgagaag
gtcactgtcgccaaggttgatgccactgccaacgatgtgcccgattccatcactggcttc
cccactatcaagctttaccccgctggtgctaaggactcccctattgagtacgccggttcc
cgtaccgttgaggacctggtcaccttcatcaaggagaacggcaagtaccaggtcgatggc
ttggccgatggtgccaagacccccgaggagcgtgccgaggtcactgcggcccccaaggcc
actgagtctcctgcatccgaggagaaggatagtcacgatgagctttaa

DBGET integrated database retrieval system