KEGG   Penicillium chrysogenum: Pc21g11280Help
Entry
Pc21g11280        CDS       T01091                                 

Definition
Pc21g11280
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pcs04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 515 aa AA seqDB search
MRSFAPLVLSLLGATAAVHAAEPEVADADANVVTLTTDTFNDFIKEHPLVLAEFYAPWCG
HCKALAPKYEEAATELKAKDIPVVKVDCTEEEELCRTYEVDGYPTLKVFRGPDSHKPYAG
ARKADAIVSYMTKQSMPAVSNVNEENLEEFKALDKIVIIGYVASDDKAANKSFTSFAESQ
RDNFLFAASNDAALAKAEGAKQPSIVLYKDFDEKKAVYDGKLDEEAILEWVKTASTPLVG
ELGPETYSKYMAAGIPLAYIFAETAEEREQFAADFRPIAESHRGAINIVTLDAKLFGAHA
GNLNLEPEKFPAFAIQDTTKNAKYPYDQTKKVDAKDIGKFIKDVLDGKVEPSLKSEPIPE
TQEGPVTVVVGRNYQEVVIDNEKDVLVEFYAPWCGHCKSLAPKYEELAALFADVPELNEK
VTVAKVDATANDVPDSITGFPTIKLYPAGAKDSPIEYAGSRTVEDLVTFIKENGKYQVDG
LADGAKTPEERAEVTAAPKATESPASEEKDSHDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcggtctttcgcccctctggtccttagcctccttggagctactgcggccgttcacgct
gctgaacctgaagttgccgacgctgacgccaatgtcgtcactttgacaactgataccttc
aacgacttcatcaaggaacaccctttggtccttgctgagttctacgcgccttggtgtggt
cactgcaaagcccttgcccccaagtatgaagaggctgccacagagctgaaggccaaagat
atccctgtggtcaaggtggattgcactgaggaggaggagctgtgccgaacctacgaggtt
gatggctaccctactctgaaggtcttccgtggacccgattcacacaagccctacgctggt
gcccgaaaggccgacgcgattgtctcatacatgaccaagcagtcaatgcccgccgtctcg
aacgtgaacgaagagaacttggaggagttcaaggccttggacaagatcgtgattatcgga
tacgtggcttcggatgacaaggccgccaacaagagcttcacttcgttcgctgaatcccag
cgtgacaacttcctcttcgctgcctccaacgatgctgctctcgccaaggctgagggtgcc
aagcagccctcgattgttctctacaaggacttcgatgagaagaaggccgtgtacgacggt
aagctggacgaggaggccatcctcgaatgggtcaagaccgctagcacccctcttgttggc
gagcttggtcccgagacttactccaagtatatggcggctggtattcccctggcttacatc
tttgccgagactgccgaggagcgtgagcagttcgctgctgacttccgtcccatcgctgag
agccaccgtggagccatcaacattgttacccttgacgctaagctcttcggcgctcacgct
ggcaacctcaaccttgagcccgagaagttccctgctttcgccatccaggacaccaccaag
aacgccaagtacccttacgaccagaccaagaaggttgatgccaaggacatcggcaagttc
atcaaggacgtccttgacggcaaggttgagcctagcttgaagtccgagcccatccccgag
actcaggagggacctgttaccgttgttgttggtcgcaactaccaggaggttgtcattgat
aacgagaaggatgtcctggtcgagttctacgctccctggtgcggacactgcaagtctctt
gctcccaagtacgaggagcttgctgctctgttcgccgatgtcccggagctgaatgagaag
gtcactgtcgccaaggttgatgccactgccaacgatgtgcccgattccatcactggcttc
cccactatcaagctttaccccgctggtgctaaggactcccctattgagtacgccggttcc
cgtaccgttgaggacctggtcaccttcatcaaggagaacggcaagtaccaggtcgatggc
ttggccgatggtgccaagacccccgaggagcgtgccgaggtcactgcggcccccaaggcc
actgagtctcctgcatccgaggagaaggatagtcacgatgagctttaa

DBGET integrated database retrieval system