KEGG   Penicillium chrysogenum: Pc21g11450Help
Entry
Pc21g11450        CDS       T01091                                 

Definition
Pc21g11450
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Pc21g11450
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Pc21g11450
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Pc21g11450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 779 aa AA seqDB search
MASCVHTDAADLNPPGPAQAVYREDCTQCFDSIDNDAGLNVCLHCFNGGCAGNRDHARLH
YKRFGHSLALNIRRTPKKVQRDEPPPKISKLSIAAETEEDRYDVATSVVCYTCSRDDVDK
SSGKLPAVIEGVMTAMTFSAKEEVKAWEQEFVPCEHTFCLVQQDNTQAGSTDSNHCSECD
LGENLWLCLECGNKGCGRSQFGGSKGNSHGLTHANSTSHAVAVKLGSITAEGSADVYCYK
CNEERVDPELATHLAHWGIYLAGREKTEKSLMEMQVEHNLKWEFSMTTEDGRELTPVFGP
AFTGLANLGNSCYLSSIMQCIFSVAGFRERYYKLSEEPPLCQAPAQDLETQLQKLADGLL
SGRYSQPDSRLLSADNPEVTHQKGLSPAMFKYLIGQGHEEFATMRQQDAFEFLLHLFKSV
SLSKHTSPQVNPVQDFRFQVEQRLQCLHCKKVRYKVDEQDNISVAVPARPATTSDGTGKE
YEPVDLSECLDIFTSAEVVELTCPACGSQDGFSKQSSFKTLPRELVVNARRFELVNWVPT
KLDIPVLVDDKPLDFSSYLAREHDPSEEQLPDIEESTTFVPNPEALDQLIGMGFPAVRCE
KALHATGNLDAEAAMNWLFAHMEDPDIDEPLVLERGGTSSSSEQDATKIAQLGDMGIEAS
RAQRALAATDGDVNRALDWVFTHPDDVVEREDPSVDDHNAQSPGGPVGLTSLPARYELRS
IVCHKGTSVHAGHYVAVVRKPLSGQSGLSWVMFNDEKVVKFEDIEAMKKSAYLYFFTRV
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttgtgtccataccgatgctgcggatctgaatccaccgggacctgcccaggct
gtttatcgagaggattgcactcagtgctttgattctattgacaatgatgccggtctaaat
gtttgtctccattgcttcaacggtggatgtgctggaaacagggaccatgcccggcttcat
tacaagagatttggccattcattggctttgaatattcgaaggacccccaagaaagtacag
cgagacgagcccccgccaaagatttccaagctttccatcgcagccgaaacagaagaggat
aggtatgacgttgctacgtcagtggtgtgctatacgtgttctcgtgacgatgtggacaaa
tccagtggcaaacttcctgctgtcatcgaaggtgttatgaccgcaatgactttctcagca
aaggaagaagtcaaagcttgggagcaagagtttgttccttgcgagcatacattctgtctg
gttcaacaggacaacacgcaagccgggtcgacagattcaaaccattgctcagagtgtgac
ttgggggagaacctctggctgtgcctagaatgtggaaacaaaggttgtgggcgaagtcaa
ttcggtggaagcaagggaaactcacatgggcttactcacgcaaactcaacatcacatgcc
gtggctgtcaagctcggctccatcacagcagaaggctccgccgatgtctattgctacaag
tgcaacgaagaaagagtagacccagaactagcgactcaccttgcgcactggggaatctac
ttagctggacgtgagaaaacagagaagagtctaatggagatgcaggtcgagcataatctc
aaatgggaattttccatgacgaccgaagatggccgagaactgaccccggtctttgggcct
gcattcacaggcctagcaaatcttggaaacagctgctatctctccagtatcatgcaatgc
atattttctgtggctggatttcgtgagcgatactataagctgtcagaagaaccaccacta
tgtcaagcaccagcacaggatcttgagacacaattgcaaaagcttgccgacggtctgctc
tcaggacggtactctcaacctgattctcgccttctgtccgcagacaacccagaagtcact
catcagaaaggtttatcaccagcaatgttcaaatatcttattggccaaggtcatgaagag
ttcgcaaccatgagacagcaggatgcctttgagttccttcttcatctattcaaatcggtt
agcctatcgaaacacaccagtccgcaggttaacccggtacaggactttcgcttccaagtt
gagcagcgtcttcagtgtctgcattgcaagaaagtccgctataaagtggatgagcaagat
aacatttcggttgcggttcccgcacgtcctgctaccacttctgacgggactggaaaggaa
tatgaacctgtggatttgtcagagtgtctagacatctttacttcggcggaggtcgttgag
cttacatgtcctgcttgtggcagccaagatggcttttccaagcagtcatctttcaaaaca
ttgcctcgggaattagtggtcaatgctcgtcggtttgagctcgtcaactgggttcctaca
aagttggatatccctgtgctggtcgacgataagccacttgatttcagctcttaccttgct
cgtgagcatgaccctagtgaggagcaacttccggatattgaagaatccaccacatttgtc
ccgaatccggaagctctcgaccaactcataggcatggggttccctgctgtgaggtgtgag
aaagctttgcatgccactggtaacttggacgcggaagctgctatgaattggctgtttgcc
cacatggaagatccagatatcgatgaaccgctggtcctcgagcgaggtggcacctctagt
tctagcgagcaagatgcaacaaaaattgcgcaactaggagatatgggtattgaggcgtct
cgtgcccagcgggcgttggccgcgaccgacggagatgttaacagggcactggattgggtt
ttcactcacccggatgatgtggtggaaagggaagacccgagtgtcgacgaccacaacgca
caatctcccggtgggccggttgggctcaccagcttgcctgcccgttatgaactaaggtcg
atcgtatgccacaaaggcacatctgtccatgcaggtcattatgttgccgtggtccgcaaa
cccttgtcaggtcaaagtggcttgtcatgggtgatgttcaatgatgaaaaagttgtcaag
ttcgaagatatcgaagcgatgaagaaaagcgcatatctttacttcttcacacgggtctag

DBGET integrated database retrieval system